KEGG   Rattus norvegicus (rat): 29577Help
Entry
29577             CDS       T01003                                 

Gene name
Hes1
Definition
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
rno04330  Notch signaling pathway
rno04950  Maturity onset diabetes of the young
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    29577 (Hes1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    29577 (Hes1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29577 (Hes1)
  09162 Cancer: specific types
   05224 Breast cancer
    29577 (Hes1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    29577 (Hes1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    29577 (Hes1)
   05165 Human papillomavirus infection
    29577 (Hes1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29577 (Hes1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    29577 (Hes1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    29577 (Hes1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     29577 (Hes1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hairy_orange HLH
Motif
Other DBs
NCBI-GeneID: 29577
NCBI-ProteinID: NP_077336
RGD: 62081
Ensembl: ENSRNOG00000001720
UniProt: Q04666
Position
11q22
AA seq 281 aa AA seqDB search
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPGGPQHA
PFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFA
HSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWRN
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggacaaaccaaagacagcctctgagcacagaaagtcatcaaagcct
atcatggagaagaggcgccgggcaagaataaatgaaagtttgagccaactgaaaacactg
attttggatgcacttaagaaagatagctcccggcattccaagctggagaaggcagacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgaccgccgctctc
agcacagacccgagcgtgttggggaagtaccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgtgagggcgttaacaccgaggtgcgcactcggctgctg
ggccacctggccaactgcatgacccagatcaacgccatgacctaccccgggcaggcgcac
cccgccttgcaggcgccgccgccgccgcccccgtcaggacctggcggtccccagcacgcg
ccattcgcgccgccgccgccgcttgtgcccatccccgggggcgcggcgccccctcccggc
agcgcaccctgcaagttgggcagccaggctggagaggctgccaaggtttttggcggcttc
caagtggtgccggctcctgacggccaatttgctttcctcatccccaatggggccttcgcc
cacagcggcccggtcatcccggtctacaccagcaacagcgggacctcggtgggtcctaac
gcagtgtcgccttccagcggctcctcgctcactgcggactccatgtggaggccgtggcgg
aactga

DBGET integrated database retrieval system