KEGG   Rattus norvegicus (rat): 29578
Entry
29578             CDS       T01003                                 

Gene name
Hnrnpa1, Hnrpa1, hnRNP_A1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    29578 (Hnrnpa1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29578 (Hnrnpa1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    29578 (Hnrnpa1)
   03041 Spliceosome [BR:rno03041]
    29578 (Hnrnpa1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     29578 (Hnrnpa1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     29578 (Hnrnpa1)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    29578 (Hnrnpa1)
SSDB
Motif
Pfam: RRM_1 HnRNPA1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 29578
NCBI-ProteinID: NP_058944
RGD: 69234
Ensembl: ENSRNOG00000036839
UniProt: P04256
Position
7q36
AA seq 320 aa
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LCKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPR
NQGGYGGSSSSSSYGSGRRF
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtctaagtcagagtcccccaaggaaccggaacagctgcggaagctcttcattggaggg
ctgagcttcgaaacaaccgacgagagtctgaggagccattttgagcaatggggaacactc
accgactgtgtggtaatgagagatccaaacaccaaaagatccagaggctttgggtttgtc
acatatgccactgtggaggaagtggatgctgccatgaatgcaagaccacacaaagtggat
ggaagagttgtggaacctaagagagctgtgtcaagagaagattctcagagaccaggtgcc
cacttaactgtgaagaagatctttgttggcggtattaaagaagacactgaagaacatcac
ctacgagattattttgagcagtatgggaaaattgaagtgattgaaattatgactgacaga
ggcagtggaaaaaagaggggatttgcgtttgtcacctttgatgaccatgactctgtggat
aagattgttattcagaaataccatactgtgaatggccacaactgtgaagtaagaaaggct
ctgtgcaaacaagagatggctagtgcttcatccagccagagaggtcgaagtggttccgga
aactttggtggtggtcgtggaggtggtttcggtggcaatgacaattttggtcgaggaggg
aacttcagtggtcgtggtggctttggtggcagccgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggcaatgatggaagcaattttggaggtggtggaagctac
aatgattttggcaattacaacaaccagtcatcaaattttggaccgatgaaaggaggaaac
tttggaggcaggagctctggcccttatggtggtggaggccagtactttgctaaaccacga
aaccaaggtggctatggaggttccagcagcagcagtagctatggcagtggcaggaggttc
taa

DBGET integrated database retrieval system