KEGG   Rattus norvegicus (rat): 29581Help
Entry
29581             CDS       T01003                                 

Gene name
Htr2b
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29581 (Htr2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29581 (Htr2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29581 (Htr2b)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    29581 (Htr2b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29581 (Htr2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29581 (Htr2b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    29581 (Htr2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF1385
Motif
Other DBs
NCBI-GeneID: 29581
NCBI-ProteinID: NP_058946
RGD: 61801
Ensembl: ENSRNOG00000017625
UniProt: P30994
Position
9q35
AA seq 479 aa AA seqDB search
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLI
FAVIIPTIGGNILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWL
ISIGIAIPVPIKGIEADVVNAHNITCELTKDRFGSFMLFGSLAAFFAPLTIMIVTYFLTI
HALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKMVMLDGSHKDKILPNSTDETL
MRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCDSCNQTTLKTL
LQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM
VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcttataaaatgtctgaacaaagcacaatttctgagcacattttgcagaaa
acatgtgatcacctgatcttgactgaccgttctggattaaaggcagaatcagcagcagag
gaaatgaagcagactgccgagaaccaggggaatacagtgcactgggcagctctcctgatc
ttcgcggtaataatccccaccattggcgggaacatcctggttattctggctgtttcactg
gagaaaaggctgcagtacgctaccaactactttctaatgtccttggcggtggctgatttg
ctggttggattgtttgtgatgccgattgctctcttaacaatcatgtttgaggctacatgg
cccctcccactggccctgtgtcctgcctggttattccttgatgttctcttttcaactgcc
tccatcatgcatctctgtgccatttccctggatcgctatatagccatcaaaaagccaatt
caggccaatcagtgcaattcccggactactgcattcgtcaagattacggtggtatggtta
atttcaataggcatcgccatcccagtccctattaaaggaatagaggctgatgtggtcaac
gcacacaacatcacctgtgagctgacaaaggaccgctttggcagtttcatgctctttggg
tcactggctgctttctttgcacctctcaccatcatgatagtcacctactttctcaccatt
cacgctttgcggaagaaagcttacttggtcagaaacaggccacctcaacgcctaacacgg
tggactgtgtccacagttctccaaagggaagactcatccttttcatcaccagaaaagatg
gtgatgctggatggctctcacaaggataaaattctacctaactcaactgatgagacactg
atgagaagaatgtcctcagcaggaaaaaaaccagcccagaccatttctaatgaacagaga
gcctcaaaggtccttggaattgtgtttctcttctttctgcttatgtggtgcccctttttc
attacaaacgtaactttagctctgtgtgattcctgcaaccagactactctcaaaacactc
ctgcagatatttgtgtgggtaggctacgtttcctcgggagtgaatcctttgatctatacc
ctcttcaataagacatttcgggaagcatttggcaggtacatcacctgcaattaccaggcc
acaaagtcagtaaaagtgcttagaaagtgttctagtacactctattttgggaattcaatg
gtagaaaactctaaatttttcacaaaacatggaattcgaaatgggatcaaccctgccatg
taccagagcccagtaaggctccgaagttcaaccattcagtcttcatccatcattctcctc
aatacatttctcactgaaaacgatggtgacaaagtagaagaccaagtcagctacatatag

DBGET integrated database retrieval system