KEGG   Rattus norvegicus (rat): 295878Help
Entry
295878            CDS       T01003                                 

Gene name
Olr672, ratchr3-73130621-73129707_ORF
Definition
(RefSeq) olfactory receptor 672
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    295878 (Olr672)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    295878 (Olr672)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 295878
NCBI-ProteinID: NP_001000350
RGD: 1333913
Position
3q24
AA seq 304 aa AA seqDB search
MQNQSFVTEFILLGLSQNLNVEKMLFVLFLFIYLATIGGNMIIVITIMYSPTLLGSPMYF
FLAFLSFLDACTSSTVTPKIIIDCFYERKIMSFDCCMIQLFAVHFFTGAEVIVLASMAYD
RYVAICKPLHYSSIMTQRLCEVLVVVSWAGGFLHSIIQIIFTLQLPLCGPNVIDHYMCDL
FPLLKLACTDTHIFVFLIFANSGAICIIIFSLLLVSYGVILFSLRAHSSEGRRKALSTCG
SHIIVVLLFFVPCILIYARPTSAFSFEKNMLIFVNVLTPLLNPMVYTFRNKEMINAIRKM
WKRL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccaaagctttgtcactgagtttatactactcggactttcacagaacctgaat
gtggagaaaatgctatttgttttgtttttatttatctatcttgcaactattgggggcaac
atgataattgtgattaccatcatgtacagtcctacactgttgggctcccccatgtacttc
ttcttggccttcctgtcctttctggatgcttgcacttcttctactgtcacccccaagata
attatagactgtttctatgagagaaagatcatgtcctttgactgttgtatgatacaactg
tttgctgtccacttcttcactggggcagaagtgattgtcctggcatccatggcctatgac
cggtatgtggctatttgcaagcccctgcactactcttccatcatgacccagaggctctgt
gaagttttagttgtggtatcctgggcaggaggtttcttgcattctatcatacaaattatc
ttcactttgcagctgcctttatgtggaccaaatgtcattgatcattacatgtgtgacttg
ttcccattactgaagcttgcctgcactgacacacacatatttgtctttttaatatttgcc
aacagtggtgctatatgcattataatcttctctttattgcttgtctcctatggtgtcatc
ttgttttctctgagagcccacagctctgaaggtcgacgtaaagctctctctacctgtgga
tcccatataattgtcgtgcttttgttttttgttccatgcatattgatatatgcaagaccc
acttctgcattctcctttgagaaaaacatgcttatatttgtcaatgtcctgacaccactg
ctcaatcctatggtttacacattcaggaataaggaaatgataaatgccatcagaaaaatg
tggaaaagattgtag

DBGET integrated database retrieval system