KEGG   Rattus norvegicus (rat): 29588Help
Entry
29588             CDS       T01003                                 

Gene name
Pou3f2, Brn-2, OTF-7, oct-7
Definition
(RefSeq) POU class 3 homeobox 2
  KO
K09365  POU domain transcription factor, class 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29588 (Pou3f2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   POU domain factors
    29588 (Pou3f2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain DUF2722 HTH_31 Homeobox_KN Spt20 Presenilin Pex14_N DUF4770
Motif
Other DBs
NCBI-GeneID: 29588
NCBI-ProteinID: NP_742082
RGD: 61946
Ensembl: ENSRNOG00000006908
UniProt: G3V6U5
Position
5q21
AA seq 445 aa AA seqDB search
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGSGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLP
PSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQ
PPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTL
YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKR
TSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGT
LPGAEDVYGGSRDTPPHHGVQTPVQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcagcgtctaaccactacagcctgctcacctccagcgcctccatcgtgcac
gccgagccgcctggcggcatgcagcagggcgcggggggctaccgcgaggcacagagcctg
gtgcagggcgactacggtgcgctgcagagcaacgggcacccgctcagccacgctcaccag
tggatcaccgcgctgtcccacggcggcagcggcgggggcggcggcggtggtggaggaggc
gggggaggcggcgggggaggcggcgacggctccccgtggtccaccagccccctaggccag
ccggacatcaagccctcggtggtggtacagcagggtggccgaggcgacgagctgcacggg
ccaggagcgctgcagcagcagcaccaacagcaacagcagcagcagcaacagcaacagcag
caacaacagcaacagcagcagcagcaacaacagcgaccgccacatctggtgcaccacgct
gccaaccaccatcccgggcccggggcatggcggagtgcggcggctgcagctcaccttcct
ccctccatgggagcttccaacggtggtttgctctattcgcagcccagcttcacggtgaac
ggcatgctgggcgcaggagggcagccggctgggctgcaccaccacggcctgagggacgcc
cacgatgagccccatcatgcagaccaccacccgcatccgcactctcacccgcaccagcaa
ccgcccccgccacctcccccacaaggcccaccgggccacccaggcgcgcaccacgacccg
cactcggacgaggacacgccgacctcagacgacctggagcagttcgccaagcaattcaag
cagaggcggatcaaactaggatttactcaagcagacgtggggctggcgcttggcaccctg
tacggcaacgtcttctcgcagaccaccatctgcaggtttgaggccctgcagctgagcttc
aagaacatgtgcaagctgaagcctttgttgaacaagtggttggaagaggcagactcatcc
tcgggcagccccaccagcatagacaagatcgctgcgcaagggcgcaaacggaaaaagcgg
acctccatcgaggtgagcgtcaagggggctctggagagccatttcctcaaatgccctaag
ccctcggcccaggagatcacctccctcgcggacagcttacagctggagaaggaggtggtg
agagtttggttttgtaacaggagacagaaagagaaaaggatgacccctcccggagggact
ctgccgggcgccgaggatgtgtatggggggagtagggacacgccaccacaccacggggtg
cagacgcccgtccagtga

DBGET integrated database retrieval system