KEGG   Rattus norvegicus (rat): 29591
Entry
29591             CDS       T01003                                 

Gene name
Tgfbr1
Definition
(RefSeq) TGF-beta receptor type-1 precursor
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04068  FoxO signaling pathway
rno04144  Endocytosis
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04659  Th17 cell differentiation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05142  Chagas disease
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29591 (Tgfbr1)
   04350 TGF-beta signaling pathway
    29591 (Tgfbr1)
   04390 Hippo signaling pathway
    29591 (Tgfbr1)
   04371 Apelin signaling pathway
    29591 (Tgfbr1)
   04068 FoxO signaling pathway
    29591 (Tgfbr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29591 (Tgfbr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29591 (Tgfbr1)
  09143 Cell growth and death
   04218 Cellular senescence
    29591 (Tgfbr1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    29591 (Tgfbr1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    29591 (Tgfbr1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    29591 (Tgfbr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29591 (Tgfbr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29591 (Tgfbr1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    29591 (Tgfbr1)
   05212 Pancreatic cancer
    29591 (Tgfbr1)
   05225 Hepatocellular carcinoma
    29591 (Tgfbr1)
   05226 Gastric cancer
    29591 (Tgfbr1)
   05220 Chronic myeloid leukemia
    29591 (Tgfbr1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29591 (Tgfbr1)
   05161 Hepatitis B
    29591 (Tgfbr1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    29591 (Tgfbr1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29591 (Tgfbr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29591 (Tgfbr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29591 (Tgfbr1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     29591 (Tgfbr1)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   29591 (Tgfbr1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Haspin_kinase Psg1
Other DBs
NCBI-GeneID: 29591
NCBI-ProteinID: NP_036907
RGD: 3852
Ensembl: ENSRNOG00000007036
UniProt: Q5M9H3
Position
5
AA seq 497 aa
MEAASAALRRCLLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTYCCNQDHCNKIELPTTEKQSAGLGPVEL
AAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT
SGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREA
EIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLA
LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTID
IAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQL
PYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTAL
RIKKTLSQLSQQEGIKM
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggaggcggcgtcggctgctttgcgtcgctgcctgcttctcatcgtgttggtggcggcg
gcgacgctgctcccgggggcgaaggcattacagtgtttctgccacctctgtacaaaggac
aattttacttgtgagacagatggtctctgctttgtctcagtcaccgagaccacagacaaa
gttatacacaatagcatgtgtatagctgaaatcgacctaattccccgagacaggccattt
gtttgtgcaccatcttcaaaaacaggggcagttacgtattgctgcaatcaggatcactgc
aataaaatagaactcccaactacagaaaagcagtcagctggcctcggtcctgtggagctg
gcagctgtcattgctggtccagtctgcttcgtctgcattgcacttatgctgatggtctat
atctgccataaccgcactgtcattcaccaccgcgtaccaaatgaagaggatccctcacta
gatcgccctttcatttcagagggcaccaccttaaaagatttaatttatgatatgacaaca
tcagggtctggatcaggtttaccactgcttgttcaaagaacaattgcaaggaccattgtg
ctacaagaaagcatcggcaaaggtcggtttggagaagtttggcgaggcaaatggcgggga
gaagaagttgccgtgaagatattctcttctagagaagaacgttcatggttccgagaggca
gagatttatcagactgtaatgttacgccatgaaaatatcctggggtttatagcagcagac
aacaaagacaatggtacatggactcagctgtggttggtgtcggattatcatgagcatgga
tcccttttcgattacttgaatagatacactgttactgtggaaggaatgatcaaactcgct
ctgtccacggcaagtggtcttgcccatcttcacatggagattgttggtacccaaggaaaa
ccagctattgcccatagagatttgaaatcaaagaatatcttggtgaagaaaaatggaacc
tgttgtattgcagatttgggacttgctgtgagacatgattctgccacagatacaattgat
attgctccaaaccacagagtaggcactaaaaggtatatggcccctgaagttctagatgat
tccataaatatgaaacattttgaatccttcaaacgtgctgacatctatgcaatgggctta
gtattctgggaaatcgctcgacgctgttccattggcggaatccacgaagactaccagttg
ccttactatgatcttgtaccttctgatccatccgttgaagaaatgagaaaagtagtttgt
gaacagaagttaaggccaaatattcccaacagatggcagagctgtgaggccttgagagtg
atggccaaaattatgagagaatgttggtatgccaatggagcagctaggctgacagctttg
cgaattaaaaaaacattgtcacagctcagccaacaggaaggcatcaaaatgtaa

KEGG   Rattus norvegicus (rat): 81810
Entry
81810             CDS       T01003                                 

Gene name
Tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2 precursor
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04068  FoxO signaling pathway
rno04144  Endocytosis
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno04380  Osteoclast differentiation
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04659  Th17 cell differentiation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05142  Chagas disease
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81810 (Tgfbr2)
   04350 TGF-beta signaling pathway
    81810 (Tgfbr2)
   04390 Hippo signaling pathway
    81810 (Tgfbr2)
   04068 FoxO signaling pathway
    81810 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81810 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81810 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    81810 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    81810 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    81810 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    81810 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    81810 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81810 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    81810 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    81810 (Tgfbr2)
   05212 Pancreatic cancer
    81810 (Tgfbr2)
   05225 Hepatocellular carcinoma
    81810 (Tgfbr2)
   05226 Gastric cancer
    81810 (Tgfbr2)
   05220 Chronic myeloid leukemia
    81810 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    81810 (Tgfbr2)
   05161 Hepatitis B
    81810 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    81810 (Tgfbr2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    81810 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    81810 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81810 (Tgfbr2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     81810 (Tgfbr2)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   81810 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase ABC1 Pkinase_fungal Haspin_kinase APH
Other DBs
NCBI-GeneID: 81810
NCBI-ProteinID: NP_112394
RGD: 69651
Ensembl: ENSRNOG00000013265
UniProt: P38438 D0VED2
Position
8
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLST
CDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPT
CVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQVTGVSLLPPLGIAI
AVIAIFYCYRVHRQQKLSPSWESSKPRKLMDFSDNCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYSSWKTEKDIFSDINLK
HENILQFLTAEERKTEMGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCVAERFSE
LEHPDRLSGRSCSQEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgatctgatggcgggtgac
aacagcggtgcggtcaagcttccacagctgtgcaagttttgcgacgtgacactgtccact
tgtgacaaccagaagtcttgcatgagcaactgcagcgtcacctccatctgtgagaagccg
caggaagtctgcgtggccgtgtggaggaagaacgacaagaacattactctggagaccgtt
tgccacgaccccaagttcacctaccacggcttcactctggaagatgccacttctcccacg
tgcgtcatgaaggaaaagaaaagggcaggcgagaccttcttcatgtgctcctgtaacaca
gaggagtgtaacgattacatcatctttaatgaagaatacaccaccagcagtcctgacctg
ttgctggtcattatccaagtgacgggcgtcagcctcctgcctccgctggggattgccata
gctgtcattgccatcttctactgttaccgtgtccaccggcagcagaagttgagcccctcc
tgggagagcagcaagccccggaagctcatggatttcagcgacaactgcgccatcatcctg
gaggacgaccgctctgacatcagctctacgtgcgccaacaacatcaatcacaatacggaa
ctgctgcccatcgagctggacacgctggtggggaagggccgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcagagcagtttgagaccgtggctgtcaagatcttcccc
tacgaggaatactcctcgtggaaaacggagaaggacatcttctctgacatcaacctgaaa
cacgagaacatcctgcagttcctgacggccgaggagcggaagacggagatgggcaagcag
tactggctgatcacggcgtttcatgctaagggcaacctgcaggagtacctcactaggcac
gtcatcagctgggaggacctgcggaagctgggcagctccctggcccggggcatcgcccat
ctgcacagtgaccacactccttgtgggaggcccaagatgcccattgttcacagggacctc
aagagctctaacatcctagtgaagaacgatttgacctgttgcctgtgtgacttcgggctg
tccttgcgcctggaccctactctgtctgtggatgacctggccaacagcgggcaggtggga
acagcgagatacatggccccggaagttctagaatccaggatgaatttggagaacatggag
tccttcaagcagacggatgtctactccatggctctggtactctgggaaatgacgtctcgc
tgcaacgctgtgggagaagtgaaagattatgagcccccatttggttccaaggtgcgggag
cacccctgtgtggagagcatgaaagacaacgtgctgagagaccgaggacggcctgaaatc
cccagcttctggctcaaccaccagggcatccagatcgtgtgtgagacactgaccgagtgc
tgggaccacgaccccgaggcccgtctcacagcccagtgtgtggcagagcgcttcagtgaa
ctggagcacccagatagactctccgggaggagctgctcccaggagaagattccagaagac
ggctccctgaacactaccaaatag

DBGET integrated database retrieval system