KEGG   Rattus norvegicus (rat): 29592Help
Entry
29592             CDS       T01003                                 

Gene name
Bcat1, Bcatc
Definition
(RefSeq) branched chain amino acid transaminase 1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00280  Valine, leucine and isoleucine degradation
rno00290  Valine, leucine and isoleucine biosynthesis
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
rno01210  2-Oxocarboxylic acid metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    29592 (Bcat1)
   00280 Valine, leucine and isoleucine degradation
    29592 (Bcat1)
   00290 Valine, leucine and isoleucine biosynthesis
    29592 (Bcat1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    29592 (Bcat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    29592 (Bcat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     29592 (Bcat1)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class IV
   29592 (Bcat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 29592
NCBI-ProteinID: NP_058949
RGD: 2195
Ensembl: ENSRNOG00000015514
UniProt: P54690
Position
4q44
AA seq 411 aa AA seqDB search
MAYLSRATATLARQDCSNGCSASYAEEEELEASTESYDEEGGSEASTQTFRAKDLIITKA
DVLKKKPDPSSLVFGASFTDHMLMVEWTSKYGWDKPHIKPFENLSIHPAASVLHYAVELF
EGLKAFRGVDNKIRLFRPDLNMKRMCRSAVRTTLPEFDKEELLQCVLQLIQLDREWVPYS
TSASLYIRPTFIGIEPSLGVKKPSKALLFVILSPVGSYFSNGTFSPVSLWANPKFVRSWK
GGTGDFKMGCNYGSSLLAQCEAAENGCHQVLWLYGKENRITEVGTMNLFLYWINKDGEEE
LATPPLDGVILPGVTRQSILELGEEWGEFKVCERHITMDDLSTALEENRVKEMFGSGTAC
VVCPVASILYKGQMLHIPTMENGHKLSSRIMAKLTDIQYGRIKSEWTLELP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcctacttgtcccgggcaactgcaaccctggcccgccaggactgcagtaatggatgt
tcggcatcgtatgctgaagaagaagaattagaagcttcgaccgagtcgtatgatgaagaa
ggaggatcagaagcttcgacccagacgtttagggccaaagatctcattatcacaaaagcc
gatgtcttaaaaaagaagcccgaccccagctcgctggtctttggagcttcgttcactgac
cacatgctgatggtggagtggacctccaagtatggatgggataagcctcacatcaagcct
tttgaaaacttgtccatacatcccgctgcctctgttttgcactatgctgtggaattgttt
gaaggcttgaaggcttttcggggagttgataacaagatccgattgttccggccggacctc
aacatgaaaagaatgtgccgatctgccgtgaggaccactctgccggagtttgacaaggag
gagcttctgcaatgcgttcttcagctcatacagctcgaccgagagtgggtcccctactca
acctctgccagtctgtacatccgccccacattcatcgggattgagccatcgcttggagtc
aagaagccttctaaagctctgctctttgtgattttgagccccgtgggatcttatttttct
aatgggaccttttctccggtgtccctgtgggccaacccaaagttcgtcagatcctggaaa
ggtgggactggagacttcaagatgggctgcaactatggatcttcccttctggcgcagtgt
gaggcggcagagaacggctgtcaccaggtcctgtggctgtacggcaaggaaaaccggata
actgaagtgggcacgatgaatctcttcctctactggataaacaaagatggagaagaagaa
ctggcgacgcctccgctagatggcgtcattctcccaggagtcactcggcagagcatcctg
gagctgggagaagagtggggcgagtttaaggtgtgcgagagacacatcaccatggatgac
ctgtccaccgccctggaggagaacagagtgaaggagatgttcggctcggggacagcctgc
gttgtctgcccagttgccagtattctgtacaagggccagatgctgcacattccaaccatg
gagaatggccacaagctttcaagtcgcatcatggcaaagttgactgatatccagtatgga
cggatcaagagcgaatggacactggagttgccctaa

DBGET integrated database retrieval system