KEGG   Rattus norvegicus (rat): 295923
Entry
295923            CDS       T01003                                 
Symbol
Ndufs3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05208  Chemical carcinogenesis - reactive oxygen species
rno05415  Diabetic cardiomyopathy
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    295923 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    295923 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    295923 (Ndufs3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    295923 (Ndufs3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    295923 (Ndufs3)
   05012 Parkinson disease
    295923 (Ndufs3)
   05014 Amyotrophic lateral sclerosis
    295923 (Ndufs3)
   05016 Huntington disease
    295923 (Ndufs3)
   05020 Prion disease
    295923 (Ndufs3)
   05022 Pathways of neurodegeneration - multiple diseases
    295923 (Ndufs3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    295923 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    295923 (Ndufs3)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     295923 (Ndufs3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 295923
NCBI-ProteinID: NP_001099959
RGD: 1309406
Ensembl: ENSRNOG00000009155
UniProt: D3ZG43
Position
3:complement(76876646..76883824)
AA seq 264 aa
MASAAARVWCRGLLGAASVARGAGRPSVLLQQRVRRESAAADKRPTVRPSSDVTHKRLSA
FGEYVAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLTAVDVP
TRQNRFEIVYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFGVFFFN
HPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE
AFPAYRQPPEHLKLEAGDKKPEAK
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgtctgctgcagccagggtctggtgccgtgggctcttgggggctgcttccgtagcc
aggggggctgggcgaccctcagtgctgttgcagcagcgtgtgagaagggagagcgcggcg
gctgacaagcgccccactgtcagaccctcgagtgatgtaacccacaagcggctctcagca
tttggagagtatgtggctgaaatcttacctaagtatgtccaacaagttcaggtgacctgc
tttgatgagttagaaatctgcatccatcctgatggagtcatcccaacgataacctttctc
aaggatcataccaatgcacagttcaaatccttggctgacttgacagcagtggatgtccca
actcggcagaaccgttttgagattgtctacaacctgctgtccctgcggtttaactctagg
attcgtgtgaagacctatgcagatgagctgacagccattgactccatagtgtctgtgcac
attgcggccaattggtatgagagggaggtctgggacatgtttggagttttcttcttcaac
caccctgacttgagaaggatcctgacagattatggcttcgagggacatcctttccggaaa
gactttcccctcactggctatgttgagctacgttatgacgatgaggtgaagcgggtagtg
gctgagccagtggagttggcacaagagttccgcaagtttgacctgaacagcccctgggag
gctttccctgcctatcgtcagccccctgagcatctcaagcttgaagctggagacaagaag
cctgaagccaagtaa

DBGET integrated database retrieval system