KEGG   Rattus norvegicus (rat): 295930Help
Entry
295930            CDS       T01003                                 

Gene name
RGD1309540
Definition
(RefSeq) similar to hypothetical protein MGC40841; similar to hypothetical protein MGC4707
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 295930
NCBI-ProteinID: NP_001013940
RGD: 1309540
Ensembl: ENSRNOG00000014798
UniProt: Q5M9F0
Position
3q24
AA seq 331 aa AA seqDB search
MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENKEDISQYGIARFFTEYFNSVCQGTHI
LFREFSFIQATPHNRASFLRAFWRCFRTVGKNGDLLTMREYHCLLQLLCPDFPLELTQKA
ARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSG
QHRQRPALGDAGMLDGVEASLFCQRLENLCDRHKYSCPPPALVKEILSNVQRLTFYGFLV
ALSKHHGINQALGALPDKGDLMHDPAMDEELERLLVQVPGLVNSITATSEASCLPSRTPP
RVGSPWKPLHRSRKLDAESDGSTEETDESET
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtcccgagcgcctagctctaccggactacgagtatctggctcagcgacatgtc
ctcacgtacatggaggatgcagtgtgtcagctgctagagaacaaggaggatattagccag
tatggcattgcccggttcttcactgaatattttaacagcgtatgccaaggaactcacatt
ctcttccgggaattcagctttatacaagccacacctcacaatagggcatcattccttcgg
gccttctggagatgcttccgaaccgtaggcaaaaatggcgacctgctgaccatgagggag
taccactgtctgctgcagttattatgcccagacttcccgctcgagctcactcagaaagca
gccaggattgtgctcatggatgatgccatggactgcttgatgtctttctcagatttcctc
tttgccttccagatccagttttattactcagaatttctggagagtgtggctgccatctat
caggacttactgtcagggaaaaaccccaatacagtgattgtcccaacatcatcgagtggg
caacaccgccaacgacccgccttgggtgatgctggcatgctggatggagtggaagcatca
ctgttctgtcagcgcctggaaaacctatgtgaccggcacaagtacagctgtccaccacca
gcacttgtcaaagagatcctgagcaatgtccagaggctgactttctatggattccttgtg
gctctctcaaagcatcatgggatcaaccaagccctaggagctttgcctgacaaaggagac
ctgatgcatgacccagccatggatgaggagctggaacggctgctggtccaggtcccaggc
ctggtcaactccatcactgccacttctgaggccagctgcctgccttcccgaacccctccc
cgggttggttccccatggaaacccctccatcgctcccgcaaattggatgcagagagcgat
ggctccactgaagagacagatgagtccgagacttga

DBGET integrated database retrieval system