KEGG   Rattus norvegicus (rat): 29595Help
Entry
29595             CDS       T01003                                 

Gene name
Htr2a, 5-HT2A, 5Ht-2
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29595 (Htr2a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29595 (Htr2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29595 (Htr2a)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    29595 (Htr2a)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29595 (Htr2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29595 (Htr2a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    29595 (Htr2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 29595
NCBI-ProteinID: NP_058950
RGD: 61800
Ensembl: ENSRNOG00000010063
UniProt: P14842
Position
15q11
AA seq 471 aa AA seqDB search
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaaattctttgtgaagacaatatctctctgagctcaattccaaactccttaatgcaa
ttaggtgatggcccgaggctctaccataatgacttcaactccagagatgctaacacttcg
gaagcatcgaactggacaattgatgctgaaaacagaaccaacctctcctgtgaagggtac
ctcccaccgacatgcctctccattcttcatctccaggaaaaaaactggtctgctttattg
acaactgtcgtgattattctcaccattgctggaaatatactggtcatcatggcagtgtcc
ctagaaaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcctgtgtccatgttaaccatcctgtatgggtaccgg
tggcctttgcctagcaagctctgtgcgatctggatttacctggatgtgctcttttctacg
gcatccatcatgcacctctgcgccatctccctggaccgctatgtcgccatccagaacccc
attcaccacagccgcttcaactccagaaccaaagccttcctgaaaatcattgccgtgtgg
accatatctgtaggtatatccatgccaatcccagtctttggactacaggatgattcgaag
gtctttaaggaggggagctgcctgcttgccgatgacaactttgttctcataggctctttt
gtggcatttttcatccccctaaccatcatggtgatcacctacttcctgactatcaagtca
cttcagaaagaagccaccttgtgtgtgagtgacctcagcactcgagccaaactagcctcc
ttcagcttcctccctcagagttctctgtcatcagaaaagctcttccaacggtccatccac
agagagccaggctcctacgcaggccgaaggacgatgcagtccatcagcaatgagcaaaag
gcgtgcaaggtgctgggcatcgtgttcttcctgtttgttgtaatgtggtgcccattcttc
atcaccaatatcatggccgtcatctgcaaagaatcctgcaatgaaaatgtcatcggagcc
ctgctcaatgtgtttgtctggattggttatctctcctcagctgtcaatccactggtatat
acgttgttcaataaaacttataggtccgccttctcaaggtacattcagtgtcagtacaag
gaaaacagaaagccactgcagttaattttagtgaacactataccagcattggcctacaag
tctagtcagctccaggtgggacagaaaaagaactcacaggaagatgctgagcagacagtt
gatgactgctccatggttacactggggaaacaacagtcggaagagaattgtacagacaat
attgaaaccgtgaatgaaaaggttagctgtgtgtga

DBGET integrated database retrieval system