KEGG   Rattus norvegicus (rat): 295953
Entry
295953            CDS       T01003                                 

Gene name
Rag2
Definition
(RefSeq) recombination activating 2
  KO
K10988  recombination-activating protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    295953 (Rag2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    295953 (Rag2)
SSDB
Motif
Pfam: RAG2 RAG2_PHD Kelch_5 PHD
Other DBs
NCBI-GeneID: 295953
NCBI-ProteinID: NP_001093998
RGD: 1305588
Ensembl: ENSRNOG00000004623
UniProt: G3V6K7
Position
3q31
AA seq 527 aa
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPA
VFSKDSCYLPPLRYPATCSYKGSTDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKV
TFRCTEKDLVGDVPEARYGHSIDVVYSRGKSVGVLFGGRSYMPSTQRTTEKWNSVADCLP
HVFLVDFEFGCATSYILPELQDGLSFHVSIARNDTIYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAIVTQTNNDEFVIVGGYQLENQKRMVCSIVSLGDNRIEIS
EMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQAMSEAFYFYMLRCSEDNSSEEQK
IVSNSQTSTEDAGDSTPFEDSEEFCFSAEAISFDGDDEFDTYNEDDEDDESVTGYWITCS
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNE
HVRIARALQTPKRNLPLQKPPMKSLHKKGSGKVLTPAKKSFLRRLFD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtccctgcagatggttacagtgggtcataacatagccttaattcaaccaggcttctca
ctgatgaattttgatggtcaagtttttttctttggccaaaaaggctggcctaagagatcc
tgccctactggagtctttcattttgatataaaacaaaatcatctcaaactgaagcctgca
gttttctctaaagattcctgctacctcccacctcttcgttacccagctacttgctcgtac
aaaggcagcacagactctgacaagcatcaatatatcatccacggagggaaaacgccaaac
aatgagctttccgataagatttatatcatgtctgtcgcttgcaagaataacaaaaaagtt
actttccgttgtacagagaaagacttagtaggagatgtccctgaagccagatatggccat
tccattgacgtggtatatagccgaggaaaaagtgttggtgttctctttggaggacggtca
tacatgccttctacccaaagaaccacagaaaaatggaatagtgtagctgattgcctaccc
catgttttcttggtagattttgaatttgggtgtgcaacgtcatatattctcccagaactt
caggacgggctgtcttttcatgtttctattgccagaaatgataccatttatattttggga
ggacactcacttgccagtaacatacgtcctgctaacttgtatagaataagagtagatctt
cccctgggtaccccagcagtgaattgcactgtcttgccaggaggaatctctgtctccagt
gcaattgtcactcaaacaaataatgatgaatttgttattgttggtggttatcagctggaa
aatcaaaaaaggatggtgtgtagcattgtctctctaggggacaacaggattgaaattagt
gagatggagaccccagactggaccccagatattaagcatagcaaaatatggtttggaagc
aacatgggaaacgggactgttttccttggcataccaggagacaacaagcaggctatgtca
gaagcattctatttctatatgttgagatgctctgaagataattcgagtgaggagcagaaa
attgtctcaaacagtcagacatcaactgaagatgccggggactccactccctttgaagac
tcggaagaattttgtttcagtgctgaagcaatcagctttgatggtgatgatgaatttgac
acttacaatgaagatgatgaagatgatgaatctgtaaccggctactggataacgtgttcc
cctacttgtgatgtggacatcaatacttgggttccattctattcaactgagctcaataaa
cccgccatgatctattgttctcatggggatggacactgggtgcatgcccagtgcatggat
ctggaagaacgcacactcatccacttgtcagaaggaagcaacaaatattactgcaatgag
catgtgcggatagcaagagcattacaaactcccaaaagaaacctccccttacaaaagccc
ccaatgaaatccctccacaaaaaaggctccgggaaagtcttgactcctgccaagaaatcc
tttcttaggaggttgtttgattag

DBGET integrated database retrieval system