KEGG   Rattus norvegicus (rat): 295961
Entry
295961            CDS       T01003                                 

Gene name
Apip
Definition
(RefSeq) methylthioribulose-1-phosphate dehydratase
  KO
K08964  methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    295961 (Apip)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     295961 (Apip)
SSDB
Motif
Pfam: Aldolase_II Peptidase_M15_4
Other DBs
NCBI-GeneID: 295961
NCBI-ProteinID: NP_001099962
RGD: 1564562
Ensembl: ENSRNOG00000007446
Position
3
AA seq 170 aa
MFVCDINEQDISGPPASKNLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGQE
FKITHQEMIKGIRKCTSGGYYRYDDILVVPIIENTPEEKDLKERMARAMNEYPDSCAVLV
RRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKMGLDPTQFPVGEHGIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtttgtttgtgacatcaatgagcaggacataagtgggcctccagcatctaagaatctt
aagaaaagccagtgtacgcctcttttcatgaacgcttacaccatgagaggagcaggcgca
gtgattcatacccactctaaagctgctgtgatggctacccttctgtttccaggacaggag
tttaaaattacacatcaagagatgatcaaaggaataaggaaatgtacctctggagggtat
tacagatacgatgatatattagtggtacccattattgagaacactcctgaagagaaggac
ctcaaagaacggatggctcgtgccatgaatgaatacccagactcctgtgcagttctagtc
aggcgtcacggggtgtacgtgtggggagaaacatgggagaaagcaaaaaccatgtgtgag
tgttatgattacctgtttgacattgctgtctccatgaagaagatggggctggatccaacg
cagttcccagttggagaacatggaatcgtataa

DBGET integrated database retrieval system