KEGG   Rattus norvegicus (rat): 29597Help
Entry
29597             CDS       T01003                                 

Gene name
P2ry2, P2Y2
Definition
(RefSeq) purinergic receptor P2Y2
  KO
K04269  P2Y purinoceptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29597 (P2ry2)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29597 (P2ry2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29597 (P2ry2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    29597 (P2ry2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 29597
NCBI-ProteinID: NP_058951
RGD: 62088
Ensembl: ENSRNOG00000019283
UniProt: P41232
Position
1q32
AA seq 374 aa AA seqDB search
MAAGLDSWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC
RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYAQGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLHSLSWGHARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR
ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSIILVCYVLMARRLLKPAYGTTGLPRAKR
KSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSCL
DPVLYFLAGQRLVRFARDAKPATEPTPSPQARRKLGLHRPNRTDTVRKDLSISSDDSRRT
ESTPAGSETKDIRL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaggcctggactcctggaatagtaccatcaatggcacctgggagggggacgaa
ctgggttacaaatgtcgcttcaacgaggacttcaagtatgtgctgctgcccgtgtcctat
ggcgtggtgtgcgtgctcgggctgtgcctgaacgtcgtggccctctacatcttcctgtgc
cgcctcaagacctggaacgcctccaccacctacatgtttcacctggcagtttctgactct
ctctacgcagcctccctgccgctgctggtttattactacgcccagggtgaccactggcca
tttagcacagtgctctgcaagctggtgcgtttccttttctacactaacctctactgcagc
atcctcttcctcacctgcatcagcgtgcaccggtgcctgggggtcctgcgccctctgcac
tccctgagctggggccatgcccgctatgcccgccgagtggctgcggttgtgtgggtgcta
gtgctggcctgccaggcacccgtgctctactttgtcaccaccagcgtgagagggacccga
atcacctgccacgacacctcggcccgagagctctttagccattttgtggcttacagctct
gtcatgctgggtctgctttttgctgtgcccttttccatcatcctggtctgttacgtgctc
atggcccgacggctgctcaaaccggcttatgggaccacaggtctgcctcgggccaagcgc
aagtctgtgcgcaccatcgccttagtactggccgtcttcgccctctgcttcctgcctttc
cacgtcacccgcaccctctattactccttccgatcacttgacctcagttgccacaccctc
aacgccatcaacatggcgtataagatcacccggccactggccagcgccaacagttgcctt
gaccctgtgctctacttcctggcagggcagagactggtccgctttgcccgagatgccaag
cccgccacagagcctacacccagcccacaggctcgtcgcaagctggggctgcacaggcct
aacagaactgacactgtgaggaaagatttgtcgatcagcagtgatgactcaagaaggaca
gagtccacaccagctggaagtgagactaaggacattcgtctatag

DBGET integrated database retrieval system