KEGG   Rattus norvegicus (rat): 29598Help
Entry
29598             CDS       T01003                                 

Gene name
Atp2b1, Pmca1a, Pmca1b, Pmca1c
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29598 (Atp2b1)
   04024 cAMP signaling pathway
    29598 (Atp2b1)
   04022 cGMP-PKG signaling pathway
    29598 (Atp2b1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29598 (Atp2b1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29598 (Atp2b1)
  09154 Digestive system
   04970 Salivary secretion
    29598 (Atp2b1)
   04972 Pancreatic secretion
    29598 (Atp2b1)
   04978 Mineral absorption
    29598 (Atp2b1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29598 (Atp2b1)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     29598 (Atp2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Cation_ATPase_N ATP_Ca_trans_C Hydrolase Hydrolase_3 DUF2201_N
Motif
Other DBs
NCBI-GeneID: 29598
NCBI-ProteinID: NP_445763
RGD: 621303
Ensembl: ENSRNOG00000004026
UniProt: P11505
Position
7q13
AA seq 1176 aa AA seqDB search
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGFLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSFRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDVVTGLTCIAVVGIEDPVRPEVPEAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGGSIQGALRRQPSI
ASQHHDVTNVSTPTHVVFSSSTASTPVGYPSGECIS
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcatatagtggtgtgaaaaactctttgaaagaa
gctaatcatgatggcgactttggcatcacacttgccgagctgcgggccctcatggagctc
aggtccacagatgcattacgaaaaatacaggaaagctatggggatgtctatggaatttgc
accaagttgaaaacatctcccaatgaaggtttaagtggaaatcctgcagatttagaaaga
agagaagcagtgtttggaaagaactttatacctcctaagaagccaaaaacctttcttcag
ttagtatgggaagcattacaagatgtcactttaattatactagaaatcgcagccatagta
tcattgggcctttctttttatcaacctccggaaggggataatgcactttgtggagaagtt
tctgttggggaagaagaaggtgaaggagaaacggggtggattgaaggagctgccatcctc
ttgtcggtggtgtgtgtggtgttagtgacggctttcaatgactggagtaaggagaaacag
ttccgaggcttgcagagtcgaattgaacaggaacagaagttcaccgtcatcaggggtggg
caggtcatccagatacctgtagctgacattactgttggagacattgcccaagtgaagtac
ggtgatcttcttccagctgatggtatattgattcaaggcaatgaccttaaaattgacgag
agttcgttgactggcgagtctgaccatgttaagaagtctctagataaagaccccttgctt
ctttcaggtactcatgtaatggaaggttctggaaggatggtcgttactgctgtaggtgtg
aactctcaaactgggatcatctttaccttacttggagctggaggcgaagaggaggaaaag
aaagatgagaagaagaaagaaaagaaaaataagaaacaagatggagctattgaaaatcgc
aacaaagcaaaagcccaagacggcgcggccatggagatgcagcctctgaagagtgaagaa
gggggagatggtgatgagaaagacaagaagaaagcaaatctgccaaagaaggaaaagtct
gtgttacaagggaaacttacgaagctggctgttcagattggcaaagcaggtctgctgatg
tctgccatcacggttatcatcctagtgctatattttgtgatcgataccttctgggttcag
aagaggccgtggcttgctgagtgcacgccaatctacatccagtactttgtgaagttcttc
attatcggggtcaccgttctagtggtcgcggtgccggaaggcctcccgctggccgtcacg
atctcactggcttactccgtcaagaaaatgatgaaggataacaacttggtgaggcacctg
gacgcttgtgagaccatggggaacgctacagctatctgttccgataagacggggaccctg
acgatgaacaggatgacggtcgttcaggcctacatcaacgaaaagcattataaaaaggtt
ccggaaccagaagccatcccgccaaatatcctgtcctatctggtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccggagaaagagggtggattacctcgtcat
gtggggaataaaacagaatgtgccttgttgggatttctcttggatttaaagcgggattat
caagatgttagaaatgaaataccagaagaagcattgtacaaagtctataccttcaattct
gttaggaaatccatgagtacagtcctaaagaattcagatggaagtttccggatcttcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gccaaagtgttccgacccagagaccgagatgacattgtgaagacggtgattgagcccatg
gcatctgaaggcctgagaaccatatgcctagcgttcagagacttccccgcaggagagcca
gaaccagagtgggataacgagaacgatgtcgtcaccggccttacttgcatcgctgttgtg
gggattgaagatcctgtgaggcctgaggtaccagaggcaataaagaaatgtcagagggct
ggaattaccgtgcgcatggtcactggtgataatattaacacagctcgggccattgctacc
aaatgcggtattttacacccaggggaagatttcctgtgcttagaaggtaaagattttaac
cgaagaatacgaaatgaaaaaggagagattgaacaagagaggatagacaagatttggcca
aagcttcgagtgcttgcaagatcatctcccactgacaaacatacactggttaaaggtata
attgacagcacagtctcagagcaacgccaggttgtagctgtgacaggggatggtacaaat
gacgggcctgcgctgaagaaagcagacgttggctttgcaatgggcattgctggaactgat
gtggctaaagaagcatctgatatcattctcacagatgacaacttcacaagcattgttaaa
gcggttatgtggggacggaatgtctatgacagcatctcaaaattccttcagttccagctt
actgttaatgtagtggccgtgattgtcgctttcacgggcgcttgtattactcaagactcg
ccactgaaggcggtacagatgctctgggtcaacctcatcatggacacgctggcctccctg
gctctggcgacagaaccacccaccgagtcactcctgctccggaagccttacgggagaaac
aagcctctcatctcacgcacaatgatgaagaatatcttgggccatgcgttctatcagctc
gtagtggtcttcacgctcttgttcgctggagagaagtttttcgatatcgacagtgggagg
aacgcccctctgcatgctccaccgtcagagcactacaccattgtgttcaacacctttgtg
ctgatgcagctcttcaatgaaataaatgcccggaaaattcatggggaaagaaatgtgttt
gaagggatcttcaacaacgccatcttctgcacaattgtcttaggcacctttgtggtgcag
ataataatcgtgcagtttggcgggaagcctttcagctgctcagaactttcaatagaacaa
tggctgtggtccatattcctgggaatggggaccttactctggggccagcttatttcaacc
attccaaccagccgcttaaagtttctaaaagaagctggccatgggacacagaaggaagag
atccctgaggaggaattggcggaggatgttgaagagattgaccatgccgaacgggagttg
cggcgtggccagatcttgtggtttagaggcctgaacagaatccaaacacagatggatgta
gtgaatgctttccagagtggaggttccattcagggggctctaaggcgacaaccctccatc
gccagccagcaccatgatgtaacaaatgtttctacccctacacatgtagtgttttcctct
tctactgcttctactcctgtggggtatccgagtggtgaatgcatttcgtag

DBGET integrated database retrieval system