KEGG   Rattus norvegicus (rat): 29599Help
Entry
29599             CDS       T01003                                 

Gene name
Atp2b3, Pmca3
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 3
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29599 (Atp2b3)
   04024 cAMP signaling pathway
    29599 (Atp2b3)
   04022 cGMP-PKG signaling pathway
    29599 (Atp2b3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29599 (Atp2b3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29599 (Atp2b3)
  09154 Digestive system
   04970 Salivary secretion
    29599 (Atp2b3)
   04972 Pancreatic secretion
    29599 (Atp2b3)
   04978 Mineral absorption
    29599 (Atp2b3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29599 (Atp2b3)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     29599 (Atp2b3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Cation_ATPase_N Hydrolase ATP_Ca_trans_C Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 29599
NCBI-ProteinID: NP_579822
RGD: 621304
Ensembl: ENSRNOG00000061304
UniProt: Q64568
Position
Xq37
AA seq 1159 aa AA seqDB search
MGDMANSSIEFHPKPQQQREVPHVGGFGCTLAELRSLMELRGAEALQKIQEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKA
GLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLP
LAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTH
YKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFILDL
KRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILN
SNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAIQEPDWDNENEVVGDLTCI
AVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGK
EFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGD
GTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQ
FQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPY
GRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLHSPPSEHYTIIFN
TFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLS
TEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTDEELAEGEEEIDHAE
RELRRGQILWFRGLNRIQTQMEVVSTFKRSGSFQGAVRRRSSVLSQLHDVTNLSTPTHVT
LSAAKPTSAAGNPSGESIP
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacatggcgaacagttccattgagttccaccccaaaccccagcagcagcgggaa
gtgcctcatgtgggtggctttggatgcacgctggcagaactacgcagcctcatggagctc
cgaggtgctgaggcactgcagaagatccaagaagcctatggggatgtcagtgggctgtgt
aggagactaaagacctcacctactgaaggcctggcagacaacaccaatgacttggagaaa
cgcaggcagatctatgggcagaacttcatccctccaaagcagcccaagaccttcctgcag
ctggtgtgggaagccctgcaggacgtgactctcatcatcctggaggtggctgctatcgtc
tccctgggcctctccttctatgcaccacctggagaggaaagtgaagcctgtgggaatgtg
tctggtggggcagaagacgaaggagaggccgaggctggctggatagagggggctgccatc
ctactctctgtcatctgtgtggtgctggtcacagccttcaatgactggagcaaggaaaag
cagttccgaggtcttcagagccgaattgagcaggaacagaagtttactgtcatccgaaat
gggcagctcctccaggtccctgtggcagccctggtggtaggggacattgcccaggtcaaa
tacggagatcttctgcctgccgatggtgtgctcatccaaggcaatgacctcaagatcgac
gagagctccctgaccggcgagtcggaccatgtgcgcaaatcagcagacaaagatcctatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtagtaacagctgttggt
gtgaactcccagacaggcatcatctttacattgcttggggcaggtggagaggaggaggag
aagaaagacaagaaagctaagaagcaggatggggctgttgccatggaaatgcagcccctg
aagagtgccgagggtggggaaatggaggagcgggaaaagaagaaagccaacgtacccaag
aaggagaagtcagtcctgcaagggaagctcacaaaactggctgtgcagattgggaaagca
ggattggtgatgtctgctatcactgtcatcattctggtcctctactttgtgattgagacc
ttcgttgtggatggccgggtgtggctggcagagtgcacaccagtgtatgtgcagtacttt
gtgaagtttttcattattggagtcactgtgttggttgtggctgtccctgagggcctgcct
cttgctgttactatctccttggcttactctgttaagaaaatgatgaaggacaataacctg
gtacgccacctggatgcctgtgagaccatgggcaatgccacagccatctgttctgacaag
acaggcacactcaccaccaaccgtatgacagtggttcagtcctacctaggagacacccac
tacaaagagattccagctcccagcgccctgacccccaagatcctcgaccttctggttcat
gccatctccatcaacagtgcctacaccaccaaaattctacctccagagaaagaaggcgct
ctcccacgccaagtgggcaacaaaacagagtgtgctcttttgggcttcatcttggacctg
aaacgtgacttccaacctgtacgggaacagataccagaagatcagctttacaaagtgtac
accttcaactcagttcgcaagtccatgagcacagttatccgaatgcctgatggtggcttc
cgcctcttcagcaagggagcctcagagatcctgctcaaaaagtgtacaaacatcttaaac
agcaatggtgaactccgaggatttcgtcctcgggaccgggatgacatggtaaagaagatc
attgagcctatggcttgtgatggcctccgcaccatatgcatcgcctacagggacttctct
gctatccaggaaccggactgggacaatgagaatgaggtggtgggtgaccttacctgcata
gctgtcgtgggcatcgaggaccctgtgcgacctgaggtccctgaagccattcgaaaatgc
cagcgtgctggcattacagtccgtatggtaactggagataacatcaacactgcccgggct
attgcagctaagtgtggcatcatccagccaggggaggatttcctgtgcctggaggggaag
gaattcaacagaaggattcgaaatgagaaaggcgagatagaacaggagaggctggacaag
gtgtggcccaagcttcgggtgcttgcccggtcatctcccactgataaacatactctggtc
aaaggcataattgacagcacaactggtgagcagcggcaggtggtggctgtgaccggggat
ggcaccaatgatggaccagccctcaaaaaggcagatgtgggcttcgccatgggcatcgca
ggcactgatgtggccaaggaggcctctgacatcattctgactgatgacaacttcaccagc
attgtcaaggcggtcatgtggggccgcaatgtctatgacagcatttccaagttcctgcag
tttcagttgacagtcaatgtggtagctgtgatcgtggccttcacgggtgcctgcattact
caggactctcctctcaaagctgtgcagatgttgtgggtgaacttgatcatggacacattt
gcctcacttgccctggcaacggaacccccaactgagtcactgctgctgcggaagccatat
ggccgggacaagcctctcatctcacgcaccatgatgaagaacatccttggacatgctgtt
taccagcttaccatcatctttactctgctatttgttggagagcttttctttgacattgac
agtggaaggaatgcacctctgcactcgccgccctcagagcactacaccatcatcttcaac
acatttgtcatgatgcagcttttcaatgagatcaatgctcgaaagatccatggtgagagg
aatgtctttgatggcatcttcagcaaccccatcttctgtaccattgtcctgggcaccttt
ggaattcagattgtcattgtccaatttggagggaagcccttcagctgttccccactgtcc
acagaacagtggctctggtgtctttttgttggtgttggggagctggtctggggacaggtc
attgccactatccccaccagccagctcaagtgcctgaaggaagcagggcatgggcctggg
aaggatgagatgactgatgaagagttggcggaaggggaagaagaaattgaccatgctgag
cgagagctccgcagaggccagatcctctggtttcggggcctcaaccggatccagacacag
atggaggtagtgagtaccttcaagagaagcgggtcatttcagggtgctgtgcgccggcgg
tcttcggtcctcagccagctccatgacgtaaccaatctttctacccctactcacgtaact
ctctctgccgccaagcccaccagcgctgctggcaatccgagtggtgaaagcattccgtag

DBGET integrated database retrieval system