KEGG   Rattus norvegicus (rat): 29602Help
Entry
29602             CDS       T01003                                 

Gene name
Ptgfrn
Definition
(RefSeq) prostaglandin F2 receptor inhibitor
  KO
K06729  prostaglandin F2 receptor negative regulator
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29602 (Ptgfrn)
   04090 CD molecules [BR:rno04090]
    29602 (Ptgfrn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   29602 (Ptgfrn)
  Exosomal proteins of colorectal cancer cells
   29602 (Ptgfrn)
  Exosomal proteins of bladder cancer cells
   29602 (Ptgfrn)
CD molecules [BR:rno04090]
 Proteins
  29602 (Ptgfrn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2
Motif
Other DBs
NCBI-GeneID: 29602
NCBI-ProteinID: NP_062116
RGD: 3437
Ensembl: ENSRNOG00000015655
UniProt: Q62786
Position
2q34
AA seq 879 aa AA seqDB search
MGRPAPRPLLLALLSLAVCRGRVVRVPAGTLVRVVGTELVIPCNVSDYDGPSEQNFDWSF
SSSGSSFVELASTWEVGFPAQQYRERLQRGDILLRRTANDAVELHIKNVQPSDQGHYKCS
TPSTDATVQGNYEDTMQVKVLADALVVGPSSRPPPGLSLREGEPFELRCIASTTSPLHTH
LALRWELHRGPVHRSILALSHEGRFHPGPGYEQRYHSGDVRLDTVGSDAYRLSVARALSA
DQGSYRCVVSEWITEQGSWQEIQEKAVEVATVVIQPTALQLAVPRTVSVTEGKDLDLSCN
ITTDRVDDVRPEVTWYFKKTPDTSLLASHMLARLDRDSLVHSSPHVALSHVDTRSYHLLV
RDVSKENSGYYLCLVALWAPGHNRSWHKVAEAMSAPSGVSVTWLEPEYQVYLNASKVPGF
SDDPTELQCRVIDTKRVDAGVRLTVSWYYRMNRRNDDVVASELLAVMDGDWTLRYGERSK
QRAQDGEFIFSKEHTDTFSFRIQRTTEEDRGSYYCVVSAWTRQRNSSWVKSKDVFSKPVN
IFWASEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLITAEKPVGDLSSPN
ETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAW
SPIGGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTLSVTRGDLIKLFCIVTVDGAVL
DPDDMAFDVSWFAVHSFGLDKAPILLSSLDRKGVVTTGQRDWKSTVSLERVSVLEFLLQV
HSSEDQDFGNYYCSVTPWVRSPTGSWQREAEIHSRPIFITVKMDVLNAFKYPLLIGVGLS
TVIGLLSCLIGYCSSHWCCKKEVRETRRERRRLMSMEMD
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcccggcgccgaggccgctgctgctggcgctcctatcgctggctgtctgccgc
gggcgtgtggtgagagtccctgcgggcaccctggttcgagtggtgggcactgagctggtg
atcccctgcaatgtcagtgactatgatggccccagtgagcaaaactttgactggagcttc
tcgtcttcgggaagcagctttgtggagctcgccagcacctgggaggtgggcttcccggcg
cagcagtaccgtgagcggctgcagcggggcgacatcctgttgaggaggacagccaatgat
gctgtggagctgcacataaagaatgtccagccctcggaccaaggccactacaagtgttca
actccaagcacagacgccaccgtccagggcaactatgaggacacaatgcaggttaaagtg
ctggcagatgccctggtggtgggccccagctcccggcctcctccaggcctgagcctgcgc
gagggggagccctttgaacttcgatgtatcgcatctactacgtcaccgttgcacacacac
ctggcacttcggtgggaactgcaccgtggcccagtgcaccgaagcatcctagccctaagc
cacgagggcaggtttcacccaggacctggctatgaacagcgctaccacagtggggatgta
cgcctggacacggtgggcagcgatgcctaccgcctctccgtagcccgggcactctctgca
gaccagggttcctacagatgtgtggtcagtgagtggatcacagagcaaggcagctggcaa
gaaatccaagaaaaagctgtggaagtggccactgtggtgatccagccaacagctctgcaa
ctggccgtgcccaggacagtgtctgtgaccgaaggaaaggacctggacctttcttgcaac
atcacaacagaccgtgtggatgatgtccggcctgaggtgacatggtacttcaaaaagaca
cccgatacctctttgcttgcctcccatatgctggctcggctggaccgtgattccctggta
cacagctcaccacacgttgctctcagccacgtggatacccgctcttaccatctactggtg
cgagatgttagcaaagaaaactccggttactatctatgcctcgtggccctctgggctcct
ggacacaaccggagctggcacaaggtggcagaggccatgtctgccccatctggtgtaagc
gtgacctggctagaaccagaataccaggtctacctgaatgcttctaaggtccccgggttt
tccgacgaccccacagaactgcaatgccgggtgatagacacgaagcgtgtggatgccggt
gtccgacttactgtgtcgtggtactatagaatgaaccgtcgcaatgatgacgtggtggcc
agcgagcttctcgccgtcatggacggggactggactctgagatacggggagagaagcaaa
cagcgggcccaggacggcgagtttatcttttctaaggagcacacagacacattcagtttc
cggatccaaaggactacggaggaagacaggggcagttattactgtgttgtgtctgcctgg
accaggcagaggaacagcagctgggtgaagagcaaagatgtcttctccaagcccgtcaac
atattctgggcctcggaagattctgtgctcgtggtgaaggcacggcagccaaagcctttc
tttgctgcagggaatacatttgagatgacttgcaaagtgtcttccaagaatattaagtct
ccacgatactctgttctcatcacggctgagaagcctgttggggacctctccagtcccaat
gaaaccaagtacatcatctccctggaccaggattccgtggtgaagctggagaactggacc
gacgcatctcgggtggacggcgtcgtgttagagaaggttcaagaggatgagttccgatac
cgaatgtaccagactcaggtctccgatgcgggcctgtaccgctgcatggtgacagcctgg
tctcctatcgggggcagcttgtggcgagaggcagcgaccagtctttccaatcctattgag
attgacttccaaacctcaggtcccatatttaacgcctctgtgcattcagacactctgtcc
gtcacccggggagatctcatcaagttgttctgtatcgtcactgtggacggagcagtgctg
gacccagatgacatggccttcgatgtatcctggtttgcagtacactcttttggcttggac
aaggctcccatcctcctatcctccttggaccggaagggagtcgtgactacaggccagagg
gactggaagagtaccgtcagcctggagcgagtgagcgtgctggaatttttgctgcaagtg
catagctctgaggaccaggactttggcaactactattgttctgtgactccctgggtgagg
tcaccaactggttcctggcagagggaagccgagatccactccaggcccatctttataact
gtgaagatggatgtgctgaacgccttcaagtacccgctgctgatcggcgtgggcctgtcc
acagtcatcgggctcctgtcctgcctcattgggtactgcagttcccattggtgctgtaag
aaggaggtgcgggagacgcgtcgggagcgccgcaggctcatgtccatggagatggattaa

DBGET integrated database retrieval system