KEGG   Rattus norvegicus (rat): 296076
Entry
296076            CDS       T01003                                 

Gene name
Srp14
Definition
(RefSeq) signal recognition particle 14 kDa protein
  KO
K03104  signal recognition particle subunit SRP14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    296076 (Srp14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    296076 (Srp14)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   296076 (Srp14)
SSDB
Motif
Pfam: SRP14
Other DBs
NCBI-GeneID: 296076
NCBI-ProteinID: NP_001099967
RGD: 1308506
Ensembl: ENSRNOG00000007512
UniProt: B2RYW7
Position
3
AA seq 110 aa
MVLLESEQFLTELTRLFQKCRSSGSVFITLKKYDGRTKPIPRKSSVEGLEPAENKCLLRA
TDGKRKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKSKKSKPAQ
NT seq 333 nt   +upstreamnt  +downstreamnt
atggtgttgctcgagagcgagcagttcctgacggagctgaccaggctcttccagaagtgc
cggtcatcgggcagcgtgttcatcaccctgaagaagtatgatggtcgcactaaaccaatc
ccacggaagagttccgtggagggcctcgagcccgcagaaaacaagtgtctgttaagggcc
acggatgggaaaaggaagatcagcacagtggtgagctccaaagaagtgaataagtttcag
atggcctattcaaatctactgagagccaacatggatgggctgaagaagagggacaagaag
aacaagagtaagaagagcaaaccagcacagtga

DBGET integrated database retrieval system