KEGG   Rattus norvegicus (rat): 296083Help
Entry
296083            CDS       T01003                                 

Gene name
Vps18
Definition
(RefSeq) VPS18 CORVET/HOPS core subunit
  KO
K20181  vacuolar protein sorting-associated protein 18
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296083 (Vps18)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    296083 (Vps18)
   Hops complex
    296083 (Vps18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep3_Vps18 Clathrin Zn_ribbon_17 zf-C3HC4_2 zf-RING_5 Vps39_2 zf-RING_2 zf-RING_UBOX zf-ANAPC11 KNOX2 zf-rbx1
Motif
Other DBs
NCBI-GeneID: 296083
NCBI-ProteinID: NP_001099969
RGD: 1311556
Ensembl: ENSRNOG00000013689
UniProt: B5DFJ4
Position
3q35
AA seq 973 aa AA seqDB search
MASILDEYEDSLSRSAVLQTGCPSVGIPHSGYVNAHLEKEVPIFTKQRIDFTPSERITSL
VVSCSQLCMSLGKDTLLRIDLGKASEPNRVELGRKDDAKVHKMFLDHTGSHLLVALSSTE
VLYMNRNGQKARPLARWKGQLVESVGWNKALGSESSTGPILVGTAQGQIFEAELSASEGG
LFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRGFVIATTRQRLFQFIGRAVEDAE
AQGFSGLFAAYTDHPPPFREFPGNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGSLDCG
RPDSLLSEEKVWEYPAGIGPGANPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFL
EKFGPLRHMVKDSSTGHLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPD
CLDTVLAREADFCFRQHRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLAGL
KPTERTQATLLTTWLTELYLSRLGALQGDPDALNLYRDTRECFRTFLSSPRHKEWLFASR
ASIHELLASHGDTEHMVYFAVIMQDYERVVTYHCQHEAYEEALAVLARHRDPQLFYKFSP
VLIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGDAQQVSQAIRYMEFCVNVLGETE
QAIHNYLLSLYARGQPASLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVL
ELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASC
PLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQEL
RGRYGTVEPQDKCSTCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPTYKQARLEELQR
KLGTAPPPTKGSVKAKEAEAGAAAVGPSREQLKADLDELVAAECVYCGELMIRSIDRPFI
DPQHYEEEHLSWL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatactggatgagtatgaggactcattgtcccgctcggccgtcttgcagact
ggttgccccagcgtgggcatcccccattctgggtatgtaaatgcccatctggagaaggag
gtgcctatcttcacaaagcagcggattgacttcaccccctccgagcgaatcaccagcctt
gttgtttcctgcagtcagctctgtatgagcctgggcaaggatacgctgctccgcattgac
ttgggcaaggcaagcgaacccaaccgtgtggagctgggccgcaaggatgatgccaaagtc
cacaagatgttcctggaccacactggctctcatctgctggttgctctgagtagcaccgag
gtcctgtacatgaaccgcaatggacagaaggcccggccgctggctcgctggaaggggcag
ctggtggagagtgtgggttggaacaaagcgctgggcagtgagagcagcaccggccccatc
ctggttggcacagctcaaggacagatctttgaagcagagctctcagctagcgaaggcggc
ctctttggccctgcccctgatctctacttccgtccactgtatgtcttaaatgaagaaggg
ggtccagcacctgtgtgctcccttgaggcggagcgtggccctgacggacggggctttgtc
attgctaccactcggcagcgcctcttccagttcataggccgagcagtagaagatgctgaa
gcccaaggcttctcgggcctctttgcagcctatacagaccacccaccgccattccgtgag
tttcctggcaacttggggtatagtgagttggctttctatacccctaagttacgctctgca
ccccgtgcctttgcctggatgatgggagatggtgtgctgtatggctcactggactgcggg
cgccctgactccctgctgagcgaggagaaagtgtgggaatacccagcagggattggtcct
ggggccaatccacccttagccatcgtcttgacccagttccatttcctactgctgctggcg
gaccgggtggaggctgtgtgtactctaacagggcaggtggtgctacgggatcacttcctg
gagaagtttggaccactgaggcacatggtgaaggactcgtccacgggtcacctctgggcc
tacactgagcgagcagtcttccgataccacgtgcaacgtgaggctcgggatgtctggcgc
acctacctggacatgaaccgctttgacctggccaaagagtattgtcgcgagcggccagat
tgcctagacacagtcctggcccgagaggctgatttctgctttcgtcagcatcgctacctg
gagagcgcccgctgctatgctctgacccagagctattttgaggagattgccctcaagttt
ttggaggcccggcaagaagaggcactggctgagtttctgcagcggaaactggccggcttg
aagccaactgagcgtactcaggccacactactgaccacttggctgacagagctctacctg
agccggcttggtgctctgcagggtgacccagacgccctgaatctctaccgggatacacgg
gagtgcttccgtacttttctcagtagccctcggcacaaagagtggctctttgccagccgg
gcctctatccatgagctgcttgccagtcacggggacacagagcatatggtgtattttgca
gtgatcatgcaggactatgaacgggtggtcacataccactgccagcatgaggcctatgag
gaggccctggctgtgctagcccgccaccgagacccccagctcttctacaaattctcgcct
gtcctcatccgacatatcccccgccagctggtggacgcctggattgagatgggcagccgg
ctggatgcccggcagctcattcctgccctggtgaactatagccaggggggcgacgctcag
caggtgagccaagccatccgctatatggaattctgtgtgaatgtgcttggcgagactgag
caggccattcacaactacctgctgtcactgtatgcccgtggccagccagcctcacttctg
gcctacctggaacaagctggggccagcccgcaccgtgtacactatgatctcaaatatgca
cttcgactttgtgctgagcacggccaccaccgcgcctgcgtccatgtctacaaggtgttg
gagctgtatgaagaggctgtggacctggccctgcaggtggatgtggacctggccaagcag
tgtgcagacctgccagaggaggatgaggaacttcggaagaaactatggctcaagatcgct
cggcatgtggtacaggaggaggaggacgtacagacagccatggcctgcttggccagctgc
cccttgctcaagattgaggatgtgttgcccttctttcctgactttgtcacaatcgaccac
tttaaggaggcaatctgtagttcacttaaggcctacaaccaccatatccaggagctacag
cgcgagatggaggaagccacagccagcgcccagcgtatccgacgagacttgcaggagctt
cgagggcgctatggcaccgtggagccccaggacaaatgctccacctgtgacttccctttg
ctcaaccgccccttttacctttttctctgtggccacatgttccacgctgactgtctgctg
caggccgtgaggcctggccttcctacctacaaacaggccaggcttgaggagttgcagcgc
aagctcgggactgcgcctcctccaaccaaaggctctgtgaaggccaaggaggcggaagct
ggggctgcagctgtggggcccagccgggaacagctcaaggctgacctcgatgagctggtg
gctgctgagtgtgtgtactgtggggagctgatgattcgctccattgaccggcccttcatc
gacccccagcactatgaggaggaacacctcagctggctgtag

DBGET integrated database retrieval system