KEGG   Rattus norvegicus (rat): 296102Help
Entry
296102            CDS       T01003                                 

Gene name
Ell3
Definition
(RefSeq) elongation factor for RNA polymerase II 3
  KO
K15183  RNA polymerase II elongation factor ELL
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    296102 (Ell3)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    296102 (Ell3)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     296102 (Ell3)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     296102 (Ell3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Occludin_ELL ELL UPF0223 BicD
Motif
Other DBs
NCBI-GeneID: 296102
NCBI-ProteinID: NP_001011957
RGD: 1309917
Ensembl: ENSRNOG00000022868
UniProt: Q5XFX8
Position
3q35
AA seq 387 aa AA seqDB search
MEGTQEALSGKMRLLFTPAARTSLLMLRLNEAALRALQECQQQQVRPVIAFQGQRGYLRL
PGPGWSCLFSFIVSQCGQEGGGLDLVYQRLGRSGPNCLHCLGSLRERLTIWAAMDTIPAP
LLAQEHLTEGTRESESWQDSEDEPEGHPQMALQEVSDPLASNHEQSLPGSSSEPMAQWEV
RNHTYLSNREPDQPLPSSASQKRLDKKRSAPITTEEPEEKRPRALPLASSPLQGLSNQDS
PEEQDWGQDADGDSRLEQSLSVQSASESPSPEEVPDYLLQYSTIHSAEQQQAYEQDFETD
YAEYRILHARVGAASQRFTELGAEIKRLQRGTPEHKVLEDKIVQEYKKFRKRYPSYSEEK
RRCEYLHEKLSHIKGLILEFEEKNRGS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaggggacccaggaagctctgagtgggaaaatgcggctcctcttcacccctgctgct
cgaaccagcctcctgatgctaagactcaacgaggcggcgctgcgggcactacaagagtgt
cagcagcaacaggtacggccagtgatcgctttccaaggccaacgagggtatctaaggctc
ccaggtcctggatggtcctgcctcttctccttcatagtatcccagtgtggccaagagggt
ggtggcttggaccttgtgtaccaacgcttaggcagatctgggcctaactgtctccactgc
ctgggctcactgagagagcgacttactatttgggcagccatggatacgatcccagctcca
ctgttagctcaggaacacctgactgaaggtaccagagagtctgagagctggcaggacagc
gaagatgaacctgaaggccatccccagatggcactacaagaggtgtctgacccactggca
agcaaccatgaacagtcactcccaggatcctccagtgagcccatggcacagtgggaagtg
agaaaccacacttacctttcaaacagagagcctgatcagccactgccttcctctgctagc
cagaaacgcctggacaagaaacgttcagcacctataaccactgaagaaccagaggaaaaa
aggcccagagctctgcctctagcctcaagtccactacaaggactatcaaatcaggactca
ccagaggaacaagactgggggcaagatgcagatggagattccaggctggagcagagtctc
tcagttcaatcagcttctgaatccccaagccctgaggaggtaccagattatctcctgcaa
tacagcaccatccacagtgcagagcagcagcaggcctacgagcaggactttgagaccgac
tatgctgaataccgcattctgcacgcccgtgtcggggctgcaagccagaggttcacagag
ctgggggcagagatcaagagacttcagcgaggaactccagagcacaaggtgctagaagac
aagatagtccaggagtataaaaagttcagaaagcggtatcccagttacagcgaggagaag
cggcgctgtgagtacctgcatgagaaactgtcccacattaaaggtctcatcctggaattt
gaggaaaagaacaggggcagctga

DBGET integrated database retrieval system