KEGG   Rattus norvegicus (rat): 296121
Entry
296121            CDS       T01003                                 

Gene name
Usp8
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04144  Endocytosis
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    296121 (Usp8)
   04137 Mitophagy - animal
    296121 (Usp8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    296121 (Usp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    296121 (Usp8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296121 (Usp8)
   04121 Ubiquitin system [BR:rno04121]
    296121 (Usp8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     296121 (Usp8)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   296121 (Usp8)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   Others
    296121 (Usp8)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    296121 (Usp8)
SSDB
Motif
Pfam: UCH USP8_dimer UCH_1 Rhodanese Metallothio_Pro HscB_4_cys
Other DBs
NCBI-GeneID: 296121
NCBI-ProteinID: NP_001099972
RGD: 1304979
Ensembl: ENSRNOG00000010729
UniProt: D3ZN39
Position
3
AA seq 1081 aa
MPAVASVPKELYLSSSLKDLNKKTEVKPEKTSTKNYIHSAQKIFKAAEECRLDRDEERAY
VLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
QLEEKDRREEEQLQQQKRQEMGREDSGAAAKRSVENLLDSKTKIQRVNGEKSEGGAAAER
GAVTAKELYTMMMDKNTSLIIMDARKIQDYQHSCILGSLSVPEEAISPGVTANWIEAKLS
DDSKDTWKKRGSVDYVVLLDWFSSAKDLLLGTTLRSLKDALFKWESKAVLHHEPLVLEGG
YENWLLCYPQFTTNAKVTPPPRSRPEEVSVSLDFTYPSLEEPVPSKLPAQMPPPPLEANE
KAQLVTDQDGKPRPLVQSALAGPSVAPKAEASPIIQPVPATKNVPQVDRTKKPAVKLPED
HRMKSESTDQSGRVLSDRSTKPVFTSPATMLTDEEKARIHEETALLMEKNRQEKELWERQ
QKEQKEKLRREEQERKAGKTQDAEERDFTENQHKAKDGQEKRDSKQTKAEDREPPADGAQ
DATGTQRQSKSEHDASDAKVSVEGKRCPMSEVQKRPADVSSASSMSGELSAGKAQREPLT
RARSEEMGRIVPGLPLGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSVPPSTPPTHK
VKPQIPAERDREPSKLKRSYSSPDITQALQEEEKRRPAVTPTVNRENKPPCYPKAEISRL
SASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRS
NLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELLLFLM
DGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCL
TCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKK
IEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKSSLKKYNLFSVS
NHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFYTSLGPRVTEAA
T
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgcctgctgtagcttcagttcctaaagaactctacctcagttcttcactcaaagacctc
aataagaagacagaagttaaacctgagaaaaccagcaccaagaattatatacacagcgct
cagaagattttcaaggcagcagaagaatgcagactagatcgtgatgaggaaagggcctat
gtgctttatatgaaatatgtggcggtttataatcttatcaaaaagagacctgatttcaag
caacagcaggactattacctttcaatacttggacctgcaaacatcaaaaaggctattgaa
gaagctgaaagactctctgagagcctcaaactgagatacgaagaggctgaagttcggaaa
cagcttgaagaaaaggacagacgggaggaagaacagctgcagcaacagaaaaggcaggag
atgggaagagaggatagtggtgcggcggccaaacgctccgtggaaaatttactggattcc
aaaaccaaaatccaaagggtcaatggagagaagagcgaaggaggtgcagcagcagagaga
ggagcagtcacagcaaaggagctatatacaatgatgatggataaaaacacaagcctgatt
ataatggatgctcggaaaatacaggattatcagcattcctgtatcttgggctctctcagt
gttcctgaagaagctatcagtccaggagtcactgccaattggattgaagcaaagctttca
gatgattctaaagacacgtggaaaaaaagggggagtgtggactatgtggtcctgctggac
tggtttagttcagcgaaagatttgctgctcgggaccacgctacggagtctgaaagatgct
cttttcaagtgggaaagtaaagctgtcctgcaccatgagcccttggtgctggagggcggc
tatgagaactggctcctgtgctatccacagttcacaacaaatgctaaggttactccaccc
cctcggagcaggcctgaagaggtgtctgtctcattggattttacttatccctcactggaa
gaaccagttccttccaaacttcctgcccagatgccacctcctcctttagaagcaaatgag
aaggcacagttggtaactgatcaagatggtaaaccgagaccgttagtccagtcggctcta
gccggacccagtgtggctcccaaagctgaagcttcacccataattcagccagtgcctgct
acaaagaatgttccacaggttgatcgtacaaaaaaaccagcagttaagttgcctgaagat
catagaatgaaatctgaaagtacagatcagagtggaagagttctttctgaccgatccacc
aagccagtatttacctctccagccaccatgctaacagatgaagaaaaggctcgcattcat
gaagaaacagcccttcttatggaaaagaatagacaggagaaggaactgtgggaaaggcag
cagaaggaacagaaagagaagctgagaagggaggaacaagagcgcaaagctggaaagacc
caggatgcagaagaacgggacttcactgagaatcagcacaaagcaaaggatggacaagag
aagagagacagcaaacagaccaaggcagaagacagagagcccccagcagatggggcccag
gacgccacaggaacgcaaagacaaagtaagagtgaacacgatgcttccgatgctaaggta
tctgtggaaggtaaaaggtgtcccatgtcagaagtgcagaagaggccagcagatgtgtcg
tctgcatcctccatgtcgggagagctgagtgcaggcaaggctcagcgagaacctttgaca
agagcaagaagtgaagaaatggggagaattgtgccaggactgcctttaggctgggccaag
tttcttgatccaatcactgggacttttcgttactaccattcacccacaaacacggttcac
atgtatccgcctgagatggctccttcgtctgtgcctccttccacccctcccactcacaaa
gtcaagccccagatccctgctgagcgggacagggagccatccaaactgaagcgctcctac
tcctcaccagacatcactcaggccctgcaggaggaggagaagaggaggccagcagtgacc
ccgacagtcaaccgggagaacaagccgccgtgttaccctaaagctgagatctcgaggctt
tctgcttctcagattcggaacctcaatcccgtttttggaggatctggaccagctcttact
ggacttcgtaatttgggaaatacttgttacatgaactcaatattacagtgcctgtgcaat
gctccacatttggctgattatttcaaccgaaactgctaccaggacgatatcaacaggtca
aatttgttggggcataaaggtgaagtggcagaagaatttggtataatcatgaaggcactg
tggacaggacagtatagatacatcagtccaaaagactttaaagtcaccattggtaagatt
aatgaccagtttgcaggatccagccagcaagattcacaagagctgctgcttttcctcatg
gatggcctccacgaggatctaaataaggctgacaatcggaagaggcataaggaagagaac
aatgaccacctcgatgactttaaagcggcagaacatgcctggcagaagcacaagcagctc
aatgagtccattattgtcgcactctttcagggtcagttcaaatccacagtgcagtgcctc
acctgtcacaagaagtctcggacattcgaggctttcatgtatttgtctttgccactagca
tccacaagtaaatgtactttacaggactgccttagattattttccaaagaagaaaagctt
acagataacaacagattttactgcagccattgccgagctcggcgggattctctaaagaaa
atagaaatctggaaattgcctcctgtgctgttagtacacctgaaacgattctcctatgac
ggcaggtggaagcagaaactgcaaacgtccgtggatttcccattagaaaatcttgacctg
tcacagtatgttattggcccaaaaagcagtttgaagaaatataacttgttttctgtttca
aaccactacggcgggctcgatggaggccactacacggcctattgtaaaaacgcggcgagg
cagcgctggtttaagtttgatgaccacgaggtttcggacatctccgtgtcttctgtgagg
tcgtcagcagcttatatcctgttttacacctccctggggccacgcgtgactgaggcagcc
acataa

DBGET integrated database retrieval system