KEGG   Rattus norvegicus (rat): 29613
Entry
29613             CDS       T01003                                 

Gene name
Ntrk3, trkC
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 3
  KO
K05101  neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    29613 (Ntrk3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    29613 (Ntrk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29613 (Ntrk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     29613 (Ntrk3)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   29613 (Ntrk3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set TPKR_C2 ig Ig_3 LRR_8 Ig_2 C2-set_2 LRRNT LRR_4 LRR_5 TrkA_TMD LRR_6
Other DBs
NCBI-GeneID: 29613
NCBI-ProteinID: NP_001257585
RGD: 3214
Ensembl: ENSRNOG00000018674
UniProt: Q03351
Position
1q31
AA seq 864 aa
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRGLHTLNAVDMELYTGLQKLTIKNSGLRNIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEA
RLDSQSLYCISADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHMDYYQEGEVSE
GCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFPESTDFFDFESDASPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYREGPYQKGPF
SVSWQQQRLAASAASTLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWS
FGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRL
NIKEIYKILHALGKATPIYLDILG
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctctttcccctcctggaagggcag
gattcagggaacagcaatgggaacgccagcatcaacatcacggacatctcaaggaatatc
acttccatacacatagagaactggcggggcctgcacacactcaatgctgtggatatggag
ctctacacgggactccagaagctgaccatcaagaattctggactccggaatattcagccc
agagcctttgctaagaatccccacttgcgttatataaacttgtcaagtaaccggctcacc
acactctcctggcagctcttccagacgctgagtcttcgggaattgagactggagcagaac
ttcttcaactgcagctgtgacatccgctggatgcagctgtggcaggaacagggggaggca
cggctggacagccagagcctctactgcatcagtgctgatggctcccaactccccctcttc
cgcatgaacatcagtcagtgtgatctccctgagatcagtgtgagtcacgtgaacctgact
gtccgagaaggagacaatgctgtaatcacttgtaatggctctggctctcctttgcctgat
gtggactggatagtcaccggactgcagtccatcaatactcatcagaccaatctgaactgg
accaatgtacatgccatcaacttgaccctggtgaatgtgacgagcgaagacaatggtttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagcgttgctctcact
gtctactaccctccacgtgtggtgagcttggtggagcctgaggtacgcctggaacattgc
attgagtttgtggtgcgtggcaacccgacacccacgctgcattggctgtacaatggacag
ccactgagggaatccaagatcattcatatggactactaccaggagggtgaagtctcagag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactacaccctcattgct
aagaatgccctgggcacagccaaccagaccatcaacggccacttccttaaggagcccttt
ccagagagcacagatttctttgactttgagtctgatgcgagccctacacctcctatcact
gtgacccacaaaccagaggaagacacttttggggtgtccatagcagttggacttgctgct
tttgcctgcgtccttctggtggtcctctttatcatgatcaacaagtacggtcgacggtcc
aaatttggaatgaagggtcctgtggctgttatcagtggggaggaggactcagccagccca
ctgcaccatatcaaccatggcatcactacaccttcatcgctggatgctgggccggataca
gtggtcattggcatgactcgaattccagtcattgagaacccccaatatttccgtcaggga
cacaattgccacaagccagacacatatgttcaacacatcaagaggagagacatcgtgttg
aagagagaactgggtgagggagcctttggaaaggtcttcctggctgagtgctacaatcta
agccccaccaaagacaagatgcttgtggcagtgaaggccctgaaggatcccaccttggct
gccaggaaggatttccagagggaggccgagctgctcactaacctgcagcatgagcatatt
gtcaaattctatggggtctgtggtgatggggatccactcatcatggtctttgaatacatg
aagcatggagacctgaacaagttcctcagggcccatgggccagatgcgatgatccttgtg
gatggacagccacgccaggccaagggggagctaggactctcccagatgctccacatcgcc
agtcagatagcctccggcatggtgtacttggcctcccagcactttgtgcaccgggacctg
gccaccaggaactgcctagttggagccaaccttctagtgaagattggagattttggcatg
tccagggacgtctacagtactgattactacagggaagggccataccagaagggcccattc
agcgtgtcgtggcagcaacagaggctagcagcatcagcagcttccacactctttaatcca
tctggaaatgatttttgtatatggtgtgaggtgggaggacacaccatgctccccatccgc
tggatgccacctgaaagcatcatgtaccggaagtttaccacagagagtgatgtgtggagc
tttggggttattctttgggagatctttacctatgggaagcaaccatggttccagctctct
aacacagaggtcattgaatgcatcacccaaggccgtgtcttggagagaccccgagtctgc
ccaaaagaagtatatgatgtcatgctggggtgctggcagagggaaccacaacagcgactg
aatattaaggagatctacaaaatcctccatgctttggggaaggccaccccaatctacctg
gacattcttggctag

DBGET integrated database retrieval system