KEGG   Rattus norvegicus (rat): 296131
Entry
296131            CDS       T01003                                 
Symbol
Fahd2a
Name
(RefSeq) fumarylacetoacetate hydrolase domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FAA_hydrolase KH_2
Other DBs
NCBI-GeneID: 296131
NCBI-ProteinID: NP_001128306
RGD: 1563674
Ensembl: ENSRNOG00000013974
UniProt: B2RYW9
Position
3:complement(114657179..114665335)
AA seq 313 aa
MLGSGRRRLLSTLLQVQKRPCQPCRNMRLVQFQAPHLEEPHVGLESGIGGGVVDLNTFDP
ALPKTMVQFLERGETALSVARRALAAQLPLIPRSQVTFLAPVTRPDKVICVGLNYADHCQ
EQNVRVPKNPIIFSKFSSSIVGPYDSIILPPESKEVDWEVEMAVVIGKKGKHIKATDVMA
YVAGFTVAHDVSARDWQMRNGKQWLLGKTFDTFCPLGPALVTKDTIADPHNLKISCRVNG
EIVQSSNTNQMVFKTEDLIAWVSQFVTLYPGDILLTGTPPGVGMFRKPPVFLKKGDEVQC
EIEELGVIINKVV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctgggctctggtagaaggaggttgctgtcaactctgctgcaggttcagaagaggccc
tgtcaaccctgcagaaatatgagactggtacagttccaggcacctcacctggaagagcct
cacgtgggcctagagtcagggattggtgggggagttgtagacctaaacacctttgaccca
gcgctccccaagacaatggtgcagttcctggagcggggagagactgccctttcggtggca
agaagagccctggctgcccagttgccactcatccctcggtcacaggtgaccttcttagcc
cctgtcacccggccagacaaggtgatatgtgtgggcttgaattatgcagaccactgtcaa
gaacagaacgtgcgggtgcccaagaatcccatcatcttcagcaagttctccagctccatc
gtggggccctatgacagcatcatcctcccaccagagagtaaggaagttgactgggaggtg
gagatggccgtggtcattgggaagaaaggcaaacacatcaaggccacagatgtcatggct
tacgtggctggcttcactgtggctcatgatgtgagtgctcgggactggcaaatgagaaat
ggaaagcagtggttactgggaaaaacttttgatactttctgccccctgggccctgccttg
gttaccaaggataccatagcagatccacacaatctaaagatctcctgtcgagtgaatggg
gagattgtccagagcagcaacaccaaccagatggtgttcaagactgaagatctgatagcc
tgggtctcccagtttgtcactctgtacccaggggacattctcctgactgggactcctcca
ggtgtcggcatgtttaggaagcctcctgtctttctcaagaagggtgatgaagtccagtgt
gagattgaagagcttggtgtcatcatcaacaaggtggtgtga

DBGET integrated database retrieval system