KEGG   Rattus norvegicus (rat): 296134Help
Entry
296134            CDS       T01003                                 

Gene name
Mrps5
Definition
(RefSeq) mitochondrial ribosomal protein S5
  KO
K02988  small subunit ribosomal protein S5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    296134 (Mrps5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    296134 (Mrps5)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    296134 (Mrps5)
  Bacteria
    296134 (Mrps5)
  Archaea
    296134 (Mrps5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5
Motif
Other DBs
NCBI-GeneID: 296134
NCBI-ProteinID: NP_001099975
RGD: 1308318
Ensembl: ENSRNOG00000015192
UniProt: D3ZYT2
Position
3q36
AA seq 432 aa AA seqDB search
MAAAVRAAGCLPALCSAPAGHFLSRQLSLNTFPVAATSFLAAKTAFSHGSLSPRETRHNH
CLTSLSHALQTQCCISSPSNWTGQQYRPYSFFTKLTAEELWKGALAETGAGARKGRGKRT
KKKKKKDLNKGQIIGEGRSGFLWPGLNVPLIKSGVVQNIGQRSKEEQQKVEADMAEQREE
WDRKRKIKVKRERGWSGNTWGGVSIGPPDPGPNGETYEDFDTRILEVRNVFNMTAKEGRK
KSVRVLVAVGNGNGAAGFAVGKAADRADAFRKAKNRAIHYLHYIERYEGHTIFHDISLRF
KRTHIRMKKQPRGYGLRCHRAIITICRLIGIKDMYAKVNGSVNMLNLTRGLFHGLARQET
HQHLADKKGLHVVEFREECGPLPIVVASPHGALSKEPEPEPEVPDTKLDWQDVKAMQGMK
RSVWFNLKRSAT
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtacgcgctgcgggctgtctccccgcactgtgtagcgcgccggcaggt
catttcctgtctaggcagctctctttaaacacctttccagtagcagccacttcctttttg
gcagcgaagacagctttcagccatggctctttgtcaccaagggaaacaagacacaaccac
tgtctgaccagcttgagccatgcactgcagacacagtgctgcatttcctctcccagcaac
tggacgggccagcagtacagaccctacagcttcttcaccaaattgactgcagaagaactc
tggaaaggtgcactagcagagactggagctggagcaaggaaaggcagaggcaaaaggaca
aagaagaagaagaagaaggatttgaacaaaggccagattattggtgaagggcgttctggt
ttcctgtggcctggtttgaatgttcctcttataaaaagtggagttgttcagaacattggc
cagcgaagcaaagaagagcagcagaaggtggaggccgacatggctgagcagagggaagag
tgggaccggaagaggaagataaaagttaaacgggagcgcggctggagtgggaacacgtgg
ggaggtgtcagtattggccccccagacccgggacccaatggagaaacctatgaagacttt
gataccaggattcttgaggtaagaaatgttttcaatatgacagcaaaagagggaagaaag
aagtcagtccgtgtcctggttgctgttgggaatggaaacggtgctgcaggttttgccgtc
gggaaagccgctgaccgggcagacgctttcagaaaggcaaagaaccgagcgattcattat
ttgcattatatagaacgatatgaaggacacacaatattccatgatatttcactaagattc
aaaaggacacatatccggatgaagaaacagcccagaggttacggcctccgctgccacagg
gccattatcaccatctgccgcctcatcggcatcaaggacatgtatgcgaaggtcaatggg
tccgtgaacatgctcaacctcacccggggcctcttccatggcctcgcccgccaggaaacc
caccagcatctggctgataagaagggtctccacgtggtggaattccgggaggaatgtggg
cctctgcctattgtggttgcctcccctcatggggccttgagtaaggagcctgagcccgaa
cctgaggtccctgataccaaactggactggcaagacgtaaaggccatgcagggaatgaag
cgctctgtgtggtttaacttaaagaggtcggccacctga

DBGET integrated database retrieval system