KEGG   Rattus norvegicus (rat): 296137
Entry
296137            CDS       T01003                                 

Gene name
Bub1
Definition
(RefSeq) mitotic checkpoint serine/threonine-protein kinase BUB1
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    296137 (Bub1)
   04114 Oocyte meiosis
    296137 (Bub1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    296137 (Bub1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    296137 (Bub1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    296137 (Bub1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     296137 (Bub1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  BUB family
   296137 (Bub1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     296137 (Bub1)
SSDB
Motif
Pfam: Mad3_BUB1_I Pkinase PK_Tyr_Ser-Thr Mad3_BUB1_I_2
Other DBs
NCBI-GeneID: 296137
NCBI-ProteinID: NP_001099977
RGD: 1311707
Ensembl: ENSRNOG00000032778
UniProt: D4A5D3
Position
3
AA seq 1059 aa
MDNLGNVFRMFEAHMQSYKGNDPLGEWESFMKWVEENFPDNKEHLVTILEHLMKEFLDKK
NYHNDSRFISYCLKFAEYNSDRHQFFEFLYSQGVGTKSSYLYLSWAGHLEAQGEQQHASA
IFQTGIHNQAEPMELLQQQYRLFQARLTGTHLPDQATTSEPLHSAQILNQVMLTKSSPET
ENSACVPRSQGSECSGVAPSTCDEKSNIREQRVIMISKSECSVSSSMAPKPEAQQVMYCK
EKLIRGDSEFSFEELRAQKYNQRKKHEQWVSEDRNYMKRKEANAFEEQLLKQKMDELHKK
LHQVVELSHKDLPASENRPDANLVCVGQNTCSHQELRGLSLSSINQQTSENSGEKPLEEP
SVPLMVNAVNSTLLFPAISLPSLPIPVSGQSETDSRGVNQSIREFMTQSGPDKKEVCETN
KVANINDFHTTPNTSLGMVQGTPCKVQPSPTVHTKEALGFIMDMFQAPTLPDISDDKDEW
PSLDQNEDAFEAQFQKNAVFSEDWGVKKIMTLSSAFPIFEDGNKENYGLPQPKNKPLGAR
TFGERSLSKCSSRSNEMPHTDEFMDDSTVCGIRYNKTLAPSPKSIGDFTSAAQLSSTPFH
KFPADPLQIPEDKENVVATQYTHMALDSCKENMVDPSKDRKLGLIQEKISASLSCPSQPA
TGGLLTQEAVFSLETYKCTGTDRAIMEDLSDASAGLQVEWVQTSSFGNVNAPNFTIENPW
DDELILKLLSGLSKPVTSYSNTFEWQSKLPAIKTKTEFQLGSLLVYVNHLLGEGAFAQVF
EAIHGDTKSKQKCILKVQKPANSWEFYIGMQLMERLKPEVHHMFIKFYSAHLFQNGSILV
GELYSYGTLLNVINLYKNTSEKVMPQALVITFAIRMLYMVEQVHSCEIIHGDIKPDNFIL
GHRFLEQDDEDLATGLTLIDLGQSIDMKLFPKGTVFTGKCETSGFQCPEMLSNKPWNYQV
DYYGVAASIYCMLFGTYMKVKNEGGVWKPEGLFRRLPHLDMWEEFFHIMLNIPDCHNLPS
LDFLRQKMNKLLEQQYSNKIKTLRNRLIVLLSEYKRSRK
NT seq 3180 nt   +upstreamnt  +downstreamnt
atggacaacctcggaaatgtctttcgtatgtttgaagcccatatgcaaagctacaagggt
aatgacccacttggagaatgggaaagctttatgaagtgggtagaagaaaattttcctgac
aataaagaacacttggtgacaatattagaacatttaatgaaggaattcttagataagaag
aactaccacaatgattcaagattcatcagttattgcttaaaatttgctgagtacaacagt
gaccgtcatcagttttttgagtttctgtacagccagggagttggaaccaagtcatcatat
ctatacctgtcctgggcagggcatctggaagcccagggagagcagcagcatgccagtgct
atttttcaaacaggaattcacaatcaggctgaacctatggaactactacaacaacaatac
aggctattccaggcacgccttactggaacacatttgccagatcaagctacaacctcagaa
cctttgcatagtgcacagattttaaaccaagttatgttaacaaagtcaagtccagaaaca
gaaaactcagcttgcgttcctaggagtcagggttcagaatgttctggtgtggcaccttct
acttgtgacgaaaagtctaatattagggaacaaagagtgatcatgatttccaagtcagaa
tgctctgtcagctcatctatggcacccaagcctgaagctcagcaagttatgtactgcaaa
gaaaagcttatccgtggagattcggaattttcatttgaagagctgagagcccagaaatac
aatcaacgaaagaagcatgaacagtgggttagtgaagacagaaattatatgaaaaggaaa
gaagcaaatgcttttgaagagcaattattaaaacagaaaatggatgaacttcacaagaaa
ttgcatcaagtggtggaattgtctcacaaggacctgcctgcttctgagaacaggcctgac
gctaatctagtatgtgtgggacaaaatacatgctcccaccaagaactgaggggtctaagt
ctttcatccatcaatcagcagacctcagagaactcaggagagaaaccactggaagaacct
tctgttcctcttatggtaaatgctgttaacagcactttgctgttcccagccatcagcctg
ccatctcttcctattcctgtaagtggccagtcagagacagattccagaggtgtgaatcaa
agtattcgtgaattcatgacacagagtggaccagacaaaaaagaagtatgtgaaacaaat
aaagttgccaacattaatgactttcatacaactccaaacacatcattgggaatggttcaa
ggaacaccatgcaaagtgcagccatcaccaactgtccacaccaaggaagcattaggtttc
atcatggatatgtttcaggctccaacacttcctgacatttctgatgataaagatgaatgg
ccatctctagaccaaaatgaagatgcatttgaagcccagtttcaaaaaaatgcagtattt
tcagaggactggggagttaaaaagattatgactttatcatctgcttttcctatttttgaa
gacggaaacaaagaaaattatggcttaccacagcctaaaaataagcctttaggagctagg
acctttggagaacgatctctcagcaaatgttcatcaagatcaaatgaaatgcctcacact
gatgagtttatggatgactcaacagtatgtggtattcgctacaacaaaaccctagctccc
agtcctaaaagtataggagactttacatctgctgcccagctttcatctacaccattccac
aaatttccagcagatccattgcagattccagaagataaagaaaatgtggtagccacacaa
tatacacatatggctttggattcttgtaaagaaaacatggtggacccctcaaaagacaga
aagcttggtctaattcaagagaaaatttcagcatctttatcctgtcctagtcagcctgcc
acaggtggtttgctcacccaggaagcagtgttcagccttgagacttataaatgcacaggc
actgaccgtgcgatcatggaagacctatcagatgccagcgctgggctccaagttgaatgg
gtgcagactagttcatttggaaatgttaatgctccaaactttactattgagaacccatgg
gatgatgaattgattcttaaacttctatctgggctttctaagccagttacttcctattca
aatacttttgagtggcagagtaaacttccagccatcaagaccaagacagaattccagttg
ggttctttgctggtctatgtgaatcaccttcttggagaaggagcctttgctcaagtcttt
gaagctattcatggagataccaaaagtaaacagaaatgtattttgaaggtgcagaaacct
gccaactcctgggaattctacattgggatgcagctgatggaaagactaaagccagaagta
catcacatgttcatcaagttttattctgctcacttattccagaatggcagcatattagta
ggggagctctatagctatgggacattactaaatgtcattaacctctataaaaatacctct
gagaaagtgatgccccaagctctcgtcattactttcgctatcagaatgctttacatggtt
gaacaagtccacagctgcgaaatcattcatggagacattaagccagataacttcatacta
ggacacagatttttggaacaggatgatgaagacttagctaccggcttgacattgattgac
ctgggtcagagtatagatatgaaacttttccctaaaggaactgtatttacaggaaagtgt
gaaacatctggttttcagtgccctgagatgctcagtaacaagccatggaactaccaggtt
gattactatggagttgctgcatcaatatattgtatgctctttggcacttacatgaaagta
aaaaatgaaggaggagtctggaaacctgaaggtctttttagaaggcttcctcatttggat
atgtgggaggaattctttcacatcatgttgaatataccggattgtcataatcttccatct
ttggactttctgagacaaaagatgaacaagttacttgaacaacaatattccaacaaaatt
aagaccttgcgcaataggctaattgtgcttctttcagaatataagcgttcaagaaaataa

DBGET integrated database retrieval system