KEGG   Rattus norvegicus (rat): 29614Help
Entry
29614             CDS       T01003                                 

Gene name
Psme2
Definition
(RefSeq) proteasome activator subunit 2
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29614 (Psme2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29614 (Psme2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29614 (Psme2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    29614 (Psme2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA28_beta PA28_alpha Lipase_chap
Motif
Other DBs
NCBI-GeneID: 29614
NCBI-ProteinID: NP_058953
RGD: 3430
Ensembl: ENSRNOG00000019246
UniProt: Q63798
Position
15p13
AA seq 238 aa AA seqDB search
MAKPCGVRLSGEARKQVDAFRQNLFQEAEDFLCTFLPRKIISLSQLLQEDSLNVADLSSL
RAPLDIPIPDPPPKDDEMETEQEKKEVPKCGFLPGNEKLLALLALVKPEVWTLKEKCILV
ITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTAISKYFSERGDAVAKASKD
THVMDYRALVHERDEAAYGALRAMVLDLRAFYAELHHIISSNLEKIVNPKGEEKPSMY
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccttgtggggttcgcttgagtggagaagcccgtaaacaggtggatgccttc
agacaaaatcttttccaggaggctgaggacttcctttgcactttcttgccacggaaaatc
atatccctgagtcagctcttgcaagaggattccctcaatgtggctgacctctcctccctc
cgggctcctctggacatccctatcccagatcccccacccaaggatgatgagatggaaacc
gagcaggagaagaaagaagtccctaagtgtggcttcctccctgggaatgagaagcttctg
gccctgcttgccttggttaagccagaagtctggactctcaaagagaagtgcattctggta
atcacatggatccagcacctgatccccaagattgaggacggaaatgattttggggtggca
attcaggagaaggtgctggagagagtgaatgctgtcaagaccaaagtggaagccttccag
acagccatctccaagtatttctcagagcgtggggatgctgtagccaaggcctccaaggac
acccatgtaatggattaccgggccttggtgcacgagcgagatgaagcagcctatggggcg
cttagggccatggtgctggacctgagagccttctatgctgagcttcatcacatcatcagc
agcaacctagagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactga

DBGET integrated database retrieval system