KEGG   Rattus norvegicus (rat): 296188
Entry
296188            CDS       T01003                                 

Gene name
Sptlc3
Definition
(RefSeq) serine palmitoyltransferase 3
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    296188 (Sptlc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    296188 (Sptlc3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    296188 (Sptlc3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     296188 (Sptlc3)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class II
   296188 (Sptlc3)
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-GeneID: 296188
NCBI-ProteinID: NP_001099987
RGD: 1310030
Ensembl: ENSRNOG00000004443
UniProt: D4A9V0
Position
3
AA seq 563 aa
MANPRDSAVTNGTLRNPKTQPGKRQSTDCVKNGISKEAQQNRKAEEDDKLVFKPYPEPPL
YVFVFTYMGYGIGMLFGYLRDFMRNWGIEKCNAAVEREEQKDFVPLYQDFENFYTRNLYM
RIRDSWSHTVCSVPVPNFDIMEKVTDDYNWTFRHTGKVIKNVINMASYNYLGLASKYNES
MEKVKDTIEKYGVGVASTRNEMGSLDIHNELEDLMAKFLNVEAVMVFGMGFATNSTNIPI
FVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNIQNLEKLLREAIIRGQPRTGRAWK
KILILVEGVYSMEGSIVNLPQIVALKKKYKAYLYMDEAHSIGCTGTMGQGIRELFGLAPE
DIDIYMGTFTKSFAASGGYIAGKKEIVDYVRVQSHSATYATSMSPVVAAQIIRSLKIMMG
YEGNFGGVQRIQQLRENIKYFRRRLIEMGFIIYGNDYSPVVPVLLYMPAKVSAFGRLLLK
KKIAVVVVGFPATSLPEGRARFSLSSAHTREMLDTVLEVVDKIGDLLNVKYFPYKKSGRA
VLYNKENFDNEASFEEKSSEPEA
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggccaacccgagggacagtgctgttactaatgggactctacgcaatcccaagacccag
ccgggaaaaagacagagcactgattgtgtgaaaaatggaatctcgaaagaagcccagcaa
aataggaaggcagaggaggacgataaacttgtctttaagccctacccagagccaccactt
tatgtcttcgttttcacatacatgggatatggaattggcatgctgttcggctatctcaga
gacttcatgagaaactggggaatagaaaaatgcaacgcagctgtagagcgagaagaacaa
aaagattttgtgccgctgtatcaggactttgagaacttttatacaagaaacctttacatg
agaatcagagacagctggagtcacaccgtctgcagtgtcccagtacctaactttgacata
atggaaaaagtgacagatgactataactggacattcaggcatactggaaaagttatcaaa
aatgttatcaacatggcctcctacaactaccttggccttgcatcaaaatacaatgagtca
atggagaaagttaaagacactatagaaaagtatggcgtaggtgtggccagcaccagaaat
gaaatgggttccttggatatacacaacgagctggaggatctcatggctaagttcttgaat
gtggaagcagtgatggtttttgggatgggattcgcaaccaactcgacgaatatccctata
tttgttggaaagggatgcctcattttaagtgacgagttcaaccacacttcagtcatcctg
gggtctcgactctcaggcgcagtcataagacccttcaaacacaataatatacaaaaccta
gagaagctcctgagagaagctatcatccgtggccagcctcgcacgggaagagcttggaaa
aagattctcatcctggtagagggagtctacagcatggaaggttccattgtgaaccttccc
cagatagtggctctaaagaagaaatacaaggcttacctctacatggatgaagctcacagt
attggctgtacaggtaccatgggccaaggcatccgagagttgtttggactggcccctgaa
gatatcgacatatacatgggtacattcaccaaaagcttcgcggcttctggaggctatata
gctggtaaaaaggaaattgtggattatgtacgggttcagtcgcatagtgctacatatgct
acatccatgagtcctgtagtagcagcgcaaatcatcagatcattgaagataatgatggga
tatgaaggaaactttggaggtgtgcagagaatacagcaacttagagaaaacataaaatat
ttccgacggcgacttatagagatgggattcatcatctatggcaatgactactctcccgtg
gtccccgtcctcctctacatgcctgctaaagtgtctgcttttggaagacttttgcttaag
aaaaagattgcggtggtggtcgttggatttccagctacttctctgccagaaggtcgggct
aggttcagcctttcctcagctcatactcgggagatgttagacacagttttggaagttgtt
gataaaatcggtgatctcctgaatgtgaaatatttcccatacaagaagtcaggacgggct
gtactctacaataaggagaattttgacaatgaagcaagctttgaagagaagagctctgaa
ccagaagcctaa

KEGG   Rattus norvegicus (rat): 361213
Entry
361213            CDS       T01003                                 

Gene name
Sptlc1
Definition
(RefSeq) serine palmitoyltransferase 1
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    361213 (Sptlc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    361213 (Sptlc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    361213 (Sptlc1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     361213 (Sptlc1)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class II
   361213 (Sptlc1)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 361213
NCBI-ProteinID: NP_001101876
RGD: 1307140
Ensembl: ENSRNOG00000010882
UniProt: D4A2H2
Position
17
AA seq 473 aa
MATVAEQWVLVEMVQALYEAPAYHLILEGILILWIIRLVFSKTYKLQERSDLTAKEKEEL
IEEWQPEPLVPPVSRNHPALNYNIVSGPPTHNIVVNGKECVNFASFNFLGLLANPRVKAA
AFASLKKYGVGTCGPRGFYGTFDVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSK
RGDIVFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRR
FIVAEGLYMNTGTICPLPELVRLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDI
DLISANMENALASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKKKCQTIHKSLQGVSGLKVVGESLCPALHLQLEESTGSRERDMKLLQEIVEQCM
NKGIALTQARYLDKEEKCLPPPSIRVVVTVEQTDEELQRAAATIREAAQAVLL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgacggtggcggagcagtgggtgctggtggagatggtgcaggcgctgtacgaggct
ccagcataccatctaattctggaaggaatcctcatactttggataatcagactcgttttc
tctaaaacttacaagttgcaggagcgttctgaccttacagccaaggaaaaggaagaactg
attgaagaatggcagccagagcccctcgtccccccggtctccaggaaccatcctgctctc
aactacaacatcgtctccggccctccaacccataacatcgtggtgaacggaaaagagtgt
gtcaactttgcctcctttaatttcctcgggttgctggccaaccctcgggttaaggctgcg
gcttttgcatcattaaagaagtacggcgtgggtacctgtggtcccagagggttttatggc
acatttgatgtccatctggatttggaagagcgcctggcaaagtttatgaagaccgaagaa
gctatcatttactcctatggcttctccaccatagccagtgcgattcctgcgtactctaag
agaggggacattgtttttgtggacagtgcagcctgctttgctatccagaaaggactacag
gcatcacgcagtgacattaagttattcaagcacaatgacgtagctgacctggagcgactg
ctaaaagaacaagagattgaagatcaaaagaatcctcgaaaggcccgtgtgactcggcga
ttcatcgtcgcggaaggattgtatatgaacactggaaccatctgccctcttccagaactg
gtgaggttaaagtataaatacaaagcaaggatcttcctggaggagagcctgtcgttcgga
gtccttggggagcatgggcgaggagtcaccgagcactatgggatcagtattgacgacatc
gaccttatcagtgctaacatggagaatgcgctcgcttctgttgggggcttctgctgtggc
cgctctttcgtggttgaccatcagcggctctctggccaaggatactgcttttcagcttca
ctgccccccctgctagccgctgccgccattgaggccctcaacatcatggaggagaaccca
gggatttttgcagttttaaagaaaaagtgccagaccatccacaagtccctacaaggggtt
tccggtttaaaagtggtgggggagtccctttgcccagcgcttcacctccagctggaagag
agcacgggctctcgggagagagatatgaagctgcttcaggagattgtagagcaatgcatg
aataagggcatcgcattgactcaggcacgctacttggacaaggaagagaagtgccttcct
cctccaagcatcagggttgtggtcaccgtggagcagacagacgaagagctgcagagggct
gcagccaccatcagggaggcggcccaggctgtgcttttgtag

KEGG   Rattus norvegicus (rat): 366697
Entry
366697            CDS       T01003                                 

Gene name
Sptlc2
Definition
(RefSeq) serine palmitoyltransferase 2
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    366697 (Sptlc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    366697 (Sptlc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    366697 (Sptlc2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     366697 (Sptlc2)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class II
   366697 (Sptlc2)
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-GeneID: 366697
NCBI-ProteinID: NP_001032174
RGD: 1305447
Ensembl: ENSRNOG00000012210
UniProt: Q3B7D2
Position
6
AA seq 560 aa
MRPEPGGCCCRRPMRANGCVKNGEVRNGYLRSSTATIAAAGQIHHITENGGLYKRPFNEA
FEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFY
TRNLYMRIRDNWNRPICSVPGAKVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFA
RNTGSCQEAAAEVLKTYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAALTYGMGFATN
SMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPR
TRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDY
FGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITS
MKCIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAF
GREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRH
RPLPLLDRPFDETTYEETED
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcggccggagccaggaggctgctgctgccgccgcccgatgcgggcgaacggctgcgtg
aaaaacggggaagtgaggaacgggtacttgaggagcagcaccgccaccatcgcggctgcg
ggccagattcatcatattacagaaaatggaggactgtacaaaagaccgtttaatgaagct
tttgaagaaacacccatgctagttgctgtgctcacatacgtgggctatggtgtactcacc
ctctttggatatcttcgagatttcttgaggcattggagaattgaaaagtgccaccatgca
acagaaagagaagaacaaaaggactttgtgtccttgtatcaggattttgaaaacttctat
acaaggaacctctacatgaggatcagagacaactggaatcgacccatctgtagtgtgcct
ggagccaaggtggatatcatggagagacagtctcatgactacaactggtcattcaagtac
acagggaatataattaaaggtgtaataaacatgggttcctacaactatcttggatttgcg
aggaacactggatcatgtcaggaagcagctgctgaagttctcaagacatatggagcaggg
gtgtgcagcactcgccaggaaattgggaacctggacaagcacgaggaactagagaaactg
gtagcaaggttcttgggtgtggaagctgctttgacctatggcatgggatttgcgacaaat
tcaatgaacattcctgctcttgttggcaaaggttgcctgattctgagtgatgagctgaac
catgcatccttggttctaggagccagactgtcgggagcaaccattcgaatcttcaaacac
aacaatatgcaaagcttggagaagcttttaaaagatgccattgtttatggtcagcctcgg
acaagaaggccctggaagaaaatcctaatcctcgtggaaggcatatatagcatggaaggg
tctattgttcgccttcctgaagtgattgctctcaagaagaaatacaaggcatacttgtat
ctggatgaggctcacagcattggggctcttggcccttcagggcgtggtgtagtagactac
tttggcctggatcctgaggatgtagatgttatgatgggaacattcacaaagagcttcggt
gcttcaggaggatacattggcggcaagaaggagctgatagactacctacgcacacattct
cacagtgctgtgtacgccacgtcaatgtcaccacctgtgatggagcagatcatcacctcc
atgaagtgcatcatggggcaggatggcaccagtcttggcaaagaatgtatccagcagttg
gctgagaacaccaggtatttcaggagacgcctgaaggaaatggggttcatcatctatggc
aatgaagactccccggtggtgcctttgatgctctacatgccggccaaaattggcgccttt
gggagagagatgctgaagcggaacattggtgtagttgtggtgggatttcctgctacccca
atcattgagtccagagccagattttgcctgtcagcggctcataccaaagaaatacttgac
acggctttgaaggaaatagatgaagttggggatctgctgcaactgaagtactcccgccac
cggccgctgcctctgctggacaggccctttgacgagactacctatgaggagacagaagac
tga

DBGET integrated database retrieval system