KEGG   Rattus norvegicus (rat): 296190Help
Entry
296190            CDS       T01003                                 

Gene name
Ndufaf5, RGD1309829
Definition
(RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 5
  KO
K18162  NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 [EC:2.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    296190 (Ndufaf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    296190 (Ndufaf5)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     296190 (Ndufaf5)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    296190 (Ndufaf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_29 MetW Methyltransf_7 MTS Methyltransf_8 Methyltransf_32 Methyltransf_18 DREV
Motif
Other DBs
NCBI-GeneID: 296190
NCBI-ProteinID: NP_001119843
RGD: 1309829
Ensembl: ENSRNOG00000004784
UniProt: B2GV71
Position
3q41
AA seq 343 aa AA seqDB search
MLRRVVLSRLYARLGGPAVSAGRGGRRGVASSVPPSGSTSPRALNIFDRELKRKQKNWAA
RQPEPMKFDYLKEEIGSRIADRVYDIARDFPLALDIGCGRGYIAQHLNKETVGKIFQTDI
AEHALKNSIETDIPTVNILADEEFLPFPENTFDLVVSSLSLHWVNDLPRALEQIHYVLKP
DGVFVGAMFGGDTLYELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTLTVD
TDEIQVNYPGMFELMEDLKGMGESNCSWNRKALLHRDTMLAAAAVYREMYSNEDGSIPAT
YQIYHMIGWKYHDSQARPAERGSATVSFGDLARLNDTMSQGKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgacgagtcgttctttcgcgcctatacgcaaggcttggaggtcctgctgtctct
gcagggagaggtggtcgcaggggggtcgcttccagtgttcctccttcgggcagcacctcg
cccagagctctaaacatcttcgacagggaattgaagaggaagcagaagaattgggctgcc
cggcagcccgagcccatgaaatttgactacctgaaggaggagattggaagtcggattgca
gaccgtgtatacgacatagccagagattttccccttgcactggacataggatgtggaaga
ggctacatagcacaacatttgaataaggagactgtgggaaagatcttccaaacagacatt
gcagaacatgctttgaaaaattccatagaaacagatattcctactgtgaatattttagct
gatgaagaattccttcccttcccagaaaacacgtttgacctggtggttagcagcttaagt
ttgcactgggtgaatgacctccctagagcacttgaacagattcattatgtcttaaaacca
gatggagtgtttgttggtgcaatgtttggaggtgacacgctctatgaactccggtgttca
ctacagttagcagagacagaaagggaaggaggcttttccccacacatttctcctttcact
gctgtcaatgacctagggcatctgctgggaagagctggcttcaacactctgactgtggat
actgatgaaattcaagttaactatcctggaatgtttgaattgatggaagatttaaaaggg
atgggtgagagcaactgttcttggaacagaaaagccctgctgcaccgagacacaatgctg
gcagctgcggcggtgtacagagaaatgtacagcaatgaggatggttccattcctgccaca
tatcagatctaccatatgataggatggaaataccatgactctcaggcaaggccagctgaa
agaggttcagcaaccgtgtcatttggagatctagcaagactaaatgataccatgtcacag
gggaaaaaataa

DBGET integrated database retrieval system