KEGG   Rattus norvegicus (rat): 296200
Entry
296200            CDS       T01003                                 

Gene name
Mgme1, RGD1307465
Definition
(RefSeq) mitochondrial genome maintenance exonuclease 1
  KO
K19465  mitochondrial genome maintenance exonuclease 1 [EC:3.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    296200 (Mgme1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     296200 (Mgme1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    296200 (Mgme1)
SSDB
Motif
Pfam: PDDEXK_1
Other DBs
NCBI-GeneID: 296200
NCBI-ProteinID: NP_001009655
RGD: 1307465
Ensembl: ENSRNOG00000028196
UniProt: Q5PPI6
Position
3q41
AA seq 338 aa
MKPLLPICRLLRLLNRFPVKPSPPVSFSTSSYLCSQKKKSSYEAVDQAKYCRLVRSVLSR
GPVQTPESLFKEDDVLYGPVSKCKVPEQEQQARVPQHWFPIFNEEKNGKPHTNGSSSPLK
IPLQRNMIPSVTRILQHTMPSEQSFFLERWKQRMVLELGEDGFAEYTSNVFLQGKQFHEA
LESILSPQENLKGGEEHPQCGYIKSVQHILKEIGSVQALESAVQHEALQYVGLLDCVAEY
QGKLCVIDWKTSEKPKPFIQNTYDNPLQVVAYMGAVNHDANYSFQVQCGLIVVAYKDGSP
AHPHFMDEELCSKYWAKWLLRLEEYTEKQKNQSIPKPE
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaaaccgcttctgcccatctgcaggctgcttagacttttaaacagatttcctgtaaaa
ccaagccctcctgtgagtttctccacttcctcttatttgtgtagccaaaagaaaaaaagc
tcttacgaagcagtagaccaagcaaagtactgtcgtttagtacgttctgtcttgtccaga
ggcccagtccagactccagagtcattgttcaaggaagatgatgtactctatggtcctgtg
agtaagtgtaaagttccagagcaagagcagcaggcaagagttccacaacactggtttcct
atcttcaatgaagagaaaaacgggaaaccacacacaaatggttcttcaagtcctttgaag
atccctttgcaaagaaacatgatacccagtgtgacccgcatccttcagcataccatgcca
tctgaacagagtttctttttggagaggtggaaacagcggatggttctggagctgggagaa
gatggatttgcagaatatacttcaaatgtgtttttacaaggcaaacagttccatgaagcc
ttggaaagcatactttcaccccaggagaacttaaaagggggagaggagcacccccagtgt
ggctacatcaaaagcgtccagcatattctgaaagaaatcggtagtgttcaagctctggaa
agtgctgtccaacatgaagccttgcagtacgtggggctactggactgtgtggctgagtac
cagggcaagctgtgtgtgatcgattggaagacatcagaaaaaccaaaacctttcattcaa
aatacatatgacaacccactacaagttgtggcatacatgggtgctgtgaaccatgatgcc
aactacagttttcaggttcaatgtggattaattgtggtggcctataaggacgggtcccct
gcccaccctcatttcatggatgaagagctctgttccaagtattgggccaagtggcttctt
cgactagaagaatacacagaaaagcagaagaaccagagcattccaaagccagagtag

DBGET integrated database retrieval system