KEGG   Rattus norvegicus (rat): 296201Help
Entry
296201            CDS       T01003                                 

Gene name
Ovol2, Zfp339
Definition
(RefSeq) ovo-like zinc finger 2
  KO
K09216  ovo
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    296201 (Ovol2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    296201 (Ovol2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_3rep zf-C2H2_6 zf_C2H2_ZHX zf-met zf-C2H2_12 zf-H2C2_5 zf-C2H2_jaz A2L_zn_ribbon
Motif
Other DBs
NCBI-GeneID: 296201
NCBI-ProteinID: NP_001099989
RGD: 1306130
Ensembl: ENSRNOG00000006850
UniProt: D4A5U5
Position
3q41
AA seq 241 aa AA seqDB search
MSLGCLLRDPPEDCRSDGGSSSGCSCSAGEPGGAESSSSPRAPEPETPELHDAEGTDGHL
AAMQRPVARSKIKFTTGTCNDSVIHNCDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGK
GFNDTFDLKRHVRTHTGIRPYKCEVCYKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLY
VCEDCGYTGPTQEDLYLHVNSAHPGSTFLKKTSKKLAALMQNKLTSPLQENSTLSEEEEK
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgggctgtctgctccgcgacccccccgaagactgccgcagcgacggtggcagt
agcagcggctgcagctgcagcgccggggagcccggaggggccgaaagcagctcgtccccg
cgcgcgccggagcctgaaactccagagcttcacgacgccgaaggcacggatggacatctg
gcagcgatgcagcgcccggttgccaggtcaaaaatcaagtttaccactggcacgtgcaac
gactccgtgattcacaactgtgacctgtgtggcaagagtttccgtctgcagcgcatgctc
aaccgtcaccttaagtgccacaaccaggtaaagaggcacctgtgcaccttctgcggcaag
ggcttcaacgacaccttcgacctgaagaggcatgtacgcacacacacaggcattcgcccc
tacaaatgcgaggtgtgttacaaagccttcacccagcgatgttccttggagtcccacctg
aagaagatccatggggtacagcagcagtatgcctacaagcaacgtcgggacaaactctat
gtgtgtgaggattgcggctacacgggccccacccaggaggacctgtacctgcatgtgaac
agtgcccatccaggtagcacgtttctcaaaaagacttccaaaaagttggcggcccttatg
cagaacaagctgacatccccactgcaggagaattccaccctgagcgaagaggaggaaaaa
aagtga

DBGET integrated database retrieval system