KEGG   Rattus norvegicus (rat): 296219
Entry
296219            CDS       T01003                                 

Gene name
Nxt1
Definition
(RefSeq) NTF2-related export protein 1
  KO
K14285  NTF2-related export protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    296219 (Nxt1)
   03015 mRNA surveillance pathway
    296219 (Nxt1)
   03008 Ribosome biogenesis in eukaryotes
    296219 (Nxt1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    296219 (Nxt1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    296219 (Nxt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    296219 (Nxt1)
   03009 Ribosome biogenesis [BR:rno03009]
    296219 (Nxt1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     296219 (Nxt1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    296219 (Nxt1)
SSDB
Motif
Pfam: NTF2 Glyco_tran_10_N DUF4518 Cofilin_ADF
Other DBs
NCBI-GeneID: 296219
NCBI-ProteinID: NP_001099991
RGD: 1309327
Ensembl: ENSRNOG00000004700
UniProt: B2RZ65
Position
3
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDNRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatcagtagatttcaagacctatgtggaccaggcctgcagagctgcagaggaattt
gtcaacgtctactacactactatggataatcggcggcggctgctgtctcgcctgtacatg
ggcacggccactttagtatggaatggaaatgccgtttcgggacaagaatccttgagtgag
ttttttgagatgttgccttccagtgagttccaaatcaacgtggtagactgccagcctgtt
catgatgaagctacgccaagccagaccacggtccttgtggtcatctgtggaacagtgaaa
tttgagggcaacaaacagcgggacttcaaccagaacttcatcctgactgctcaggcgtca
cccagtaacacagtgtggaagatagcgagtgactgcttccgcttccaggactgggccagc
tag

KEGG   Rattus norvegicus (rat): 315352
Entry
315352            CDS       T01003                                 

Gene name
Nxt2
Definition
(RefSeq) NTF2-related export protein 2
  KO
K14285  NTF2-related export protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    315352 (Nxt2)
   03015 mRNA surveillance pathway
    315352 (Nxt2)
   03008 Ribosome biogenesis in eukaryotes
    315352 (Nxt2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    315352 (Nxt2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    315352 (Nxt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    315352 (Nxt2)
   03009 Ribosome biogenesis [BR:rno03009]
    315352 (Nxt2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     315352 (Nxt2)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    315352 (Nxt2)
SSDB
Motif
Pfam: NTF2
Other DBs
NCBI-GeneID: 315352
NCBI-ProteinID: NP_001101590
RGD: 1560204
Ensembl: ENSRNOG00000019168
UniProt: B2GV77
Position
X
AA seq 142 aa
MAMAVDFKMYVDQACRAAEEFVNIYYETMDKRRHALVRLYLDKATLIWNGNVVTGLEALA
NFFEMLPSSEFQINMLDCQPVHEQATQYQTTVLVVTSGVVKFDGNKQHFFNQNFLLTAQS
TPNSTVWKIASDCFRFQDWASI
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccatggccgtggattttaaaatgtatgtggatcaagcatgtagagctgctgaggaa
tttgtcaatatttactatgagacaatggacaaaagacggcatgcacttgtcaggctgtat
ttggacaaggccactctaatctggaatggaaatgttgttacagggctggaagcccttgct
aatttttttgagatgttgccttccagtgaattccagatcaatatgttagattgccaacca
gttcatgagcaagctacccagtaccagactacagtgctcgtcgtgaccagtggagtggtg
aagtttgatggaaacaaacaacacttctttaaccagaacttcctgttgactgcgcagagc
actcctaacagcacggtgtggaagattgcaagtgattgcttccgttttcaagattgggct
agtatttaa

DBGET integrated database retrieval system