KEGG   Rattus norvegicus (rat): 29622Help
Entry
29622             CDS       T01003                                 

Gene name
Ralgds, Rgds
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29622 (Ralgds)
   04015 Rap1 signaling pathway
    29622 (Ralgds)
   04072 Phospholipase D signaling pathway
    29622 (Ralgds)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29622 (Ralgds)
   05231 Choline metabolism in cancer
    29622 (Ralgds)
  09162 Cancer: specific types
   05210 Colorectal cancer
    29622 (Ralgds)
   05212 Pancreatic cancer
    29622 (Ralgds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA
Motif
Other DBs
NCBI-GeneID: 29622
NCBI-ProteinID: NP_062123
RGD: 3533
Ensembl: ENSRNOG00000010219
UniProt: Q03386 F1LN84
Structure
PDB: 

Position
3p12
AA seq 895 aa AA seqDB search
MVQRMWAEASGPIGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRL
ESSTQEIGEELINGVIYSISLRKVQLHPGATKGQRWLGCENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGCILPYSSEDGGPQDQ
LKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEDLE
PSEVEPEALSPAPVLSLKPASQLEPAPALLLTPSRAVASTPVREPAPVPVLASSPVVAPA
SELEPALEPPLDPEPTLAPAPELDPTVSQSLHLEPAPVPAPALEPSWPLPETTENGLCAK
PHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVAQFNN
VANCVITTCLGDQSMKASDRARVVEHWIEVARECRVLKNFSSLYAILSALQSNAIHRLKK
TWEEVSRGSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPRRTQRRQKETGV
IQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIVP
EEHFGAWFRAMGRLSEAESYNLSCELEPPSESASNTLRSKKSTAIVKRWSDRQAPSTELS
TSSSAHSKSCDQLRCSPYLSSGDITDALSVHSAGSSSSDVEEINMSFVPESPDGQEKKFW
ESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGVCSYSSSLPLYNQQVGDC
CIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDEPEDYELLQIISEDHKLK
IPENANVFYAMNSAANYDFILKKRAFTKGAKVKHGASSTLPRMKQKGLRIARGIF
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcgtccgggcccatagggggcgccgagccgttgttt
cccggctcccggcgcagccgcagcgtgtgggacgccgtgcgtctggaggtgggcgtccct
gacagctgtccagtggtgctgcacagcttcacgcagctcgaccccgatctgccgcgcctg
gagagctctacgcaggagattggggaggagctgatcaacggggtcatctactccatctcc
ctgcgcaaggttcagctacacccaggagccaccaagggccagcgctggctagggtgcgag
aatgagtcagctctgaacctctacgagacttgcaaggtgcgcacggtgaaggccggtact
ctggagaagctggtggaacacctggtgcctgccttccagggcagtgacctttcctacgtc
accgtattcctgtgcacctacagagccttcacaaccactcagcaggtgctagacctgctg
ttcaaaagatatggctgcatccttccctactccagtgaggacggcggaccacaggaccaa
ctcaaaaatgccatctcttccatcctgggcacctggctggaccaatactccgaggacttc
tgtcaacccccggactttccctgcctcaagcagctggtggcttatgtgcagctcaacatg
cctggctcagacctggagcgccgtgctcaccttctcctggcccagctggaggacctggag
cccagtgaggttgagcctgaggccctgtccccagctccagtgctgtctctgaaaccagct
tcacagctagaaccagctcccgccctgcttctgacgcccagccgagctgtggcatccact
ccagtccgagagccagccccggtgccagtactggcatccagcccggtggtggcgccagcc
tctgagctagaaccagctctggagccgcccctagaccctgagccaaccctcgcacctgct
ccagagctggaccccactgtctcacagagcctccacctcgagcccgctcccgtgcccgct
cctgcattagagccttcctggcctctgcctgaaaccacggagaacggactgtgtgcaaag
cctcacctactgctgttccctccagacttggtggctgaacagtttacgctgatggacgca
gagctattcaagaaagttgtgccctaccactgcctgggctccatctggtcccagcgggac
aagaagggcaaggagcacctcgcgcccaccatccgtgccactgtcgcccagttcaacaac
gtggccaactgtgtcatcaccacctgccttggggaccagagtatgaaagcttcggacagg
gcccgggtggtggaacactggatcgaggtggccagggagtgcagggtgctcaagaatttc
tcctccctctacgccatcctctctgccctacagagcaatgccatccaccgcctaaagaag
acatgggaagaggtctccaggggcagctttcgagtgttccagaaactgtcagaaatcttc
tctgatgagaacaactactccttgagcagagagctgctcatcaaggaaggaacctccaag
tttgccacgctggagatgaaccctaggagaacccagaggcggcagaaggagacaggtgtc
atccagggcactgtcccctacctgggcacattcctcactgacctggtgatgctggacaca
gccatgaaggactatctatatgggagactgatcaactttgaaaagaggaggaaggagttc
gaagtcatcgcccagatcaagttgctccagtcggcctgcaacaactacagcattgttccc
gaggagcactttggagcctggttccgagccatgggacggctcagcgaggctgagagctac
aacctgtcgtgtgagctggagcccccgtctgagtcagccagcaacaccctgaggagcaag
aaaagcacagctatcgtcaagcgctggagcgaccgccaggctcccagcacggagctcagc
accagtagcagtgcacactccaagtcatgtgaccagctccggtgcagcccctacctcagc
agcggggacatcacggacgcactcagtgtgcactcagctggttcatccagctctgacgtg
gaggagatcaacatgagctttgttccagagtctcctgatggccaggaaaagaagttctgg
gagtcagcctcccagtcgtccccagagacctctggcatcagctcggcctccagcagcacc
tcctcttcgtcagcctctaccacaccggtgtctaccacacgcacccacaagcgctctgtc
tcaggggtctgcagctacagctcctcactgccactctacaaccagcaggtgggcgactgc
tgcatcatcagggtcagcctggatgtggacaacggcaacatgtacaagagcatcctggtg
accagccaggataaggctccgactgtcatccggaaagccatggacaaacacaacctagat
gaggacgagcccgaggactatgagctgctgcagatcatctcagaggaccacaagctgaaa
attccagagaacgccaatgtgttctatgccatgaactctgccgccaactatgacttcatc
ctaaagaagcgggccttcactaagggggctaaagtcaagcatggagccagctccactctc
cctcgaatgaagcagaagggactcaggattgccagaggcatcttctaa

DBGET integrated database retrieval system