KEGG   Rattus norvegicus (rat): 296229
Entry
296229            CDS       T01003                                 

Gene name
P22k15
Definition
(RefSeq) cystatin-related protein 2 precursor
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 296229
NCBI-ProteinID: NP_954887
RGD: 727814
UniProt: P22283
Position
3
AA seq 176 aa
MYKTLCGTQLLLAIFVLFLNFSHATAKGTRGPMEIFKKNFMEKNKLNDVYDIFKFLYNKF
SHDTYLSNIKNQSFTMNTWGFGEIEVVKTKCRKIDSDFYKCSFQWEFCNIKRTPGVTIYY
ITLPGSVRCRKLLSKLVNCPFEEQTEQLKREICYFQLYPDYIEQNIRSVRFNCYTK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtacaaaaccctatgtggcacacagctcctactggccatctttgtcctgtttctgaac
ttcagccatgcaactgcaaaaggaaccaggggacctatggaaatttttaagaaaaacttc
atggaaaagaacaaactgaatgatgtatatgatatcttcaaatttctttacaacaagttc
agtcatgacacatatctcagcaacataaaaaatcagtcattcaccatgaacacatgggga
tttggtgaaattgaagtggttaaaaccaaatgtagaaagattgactctgacttctacaaa
tgttctttccagtgggaattctgtaacataaagcggactcctggagtaacaatatactat
ataacattgcctggaagtgtcagatgcaggaagctcctatctaaactggtcaactgtccc
ttcgaagaacaaacagaacagctgaagagagaaatatgctactttcaactgtatcctgat
tatattgagcaaaatatacgttctgtaagattcaattgttataccaaatga

DBGET integrated database retrieval system