KEGG   Rattus norvegicus (rat): 296234Help
Entry
296234            CDS       T01003                                 

Gene name
Cyss, Cst4
Definition
(RefSeq) cystatin S
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI Cathelicidins Ribosomal_S5
Motif
Other DBs
NCBI-GeneID: 296234
NCBI-ProteinID: NP_941958
RGD: 735160
Ensembl: ENSRNOG00000030857
Vega: OTTRNOG00000000990
UniProt: P19313
Position
3q41
AA seq 141 aa AA seqDB search
MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNS
DLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSF
VVHDIPWENYIVLLSSSCHSI
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcctacctgctccatgctcaactatttctactgactacctttatattagttttgaac
atgagactttgtcctgttctaggtcactttctgggtggcatagagaagtctagcatggag
gaggaaggagcctcagaagcattgaactatgctgtcaatgagtataatgaaaagaacagt
gacttgtacctgagccgtgtggtggaagtgaaggatgtccaaaagcaggtggtggctgga
accaaatttttctttgatgtgattctaggcaaaacaatatgtttgaagacacagggtgac
ttgaccaactgtcccttaaatgaagaggctgatcagcaggagcatgaattctgctctttc
gtggttcatgatatcccatgggagaattatattgtcttgctgagctccagctgtcatagt
atatga

DBGET integrated database retrieval system