KEGG   Rattus norvegicus (rat): 296267Help
Entry
296267            CDS       T01003                                 

Gene name
Snph
Definition
(RefSeq) syntaphilin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaphilin CALCOCO1 Fez1 Exonuc_VII_L Lebercilin MPS2 Sec2p DUF641 Spc7 ArAE_1_C HMMR_N PKcGMP_CC CC2-LZ BST2
Motif
Other DBs
NCBI-GeneID: 296267
NCBI-ProteinID: NP_001099995
RGD: 1305867
Ensembl: ENSRNOG00000009588
UniProt: B5DF41
Position
3q41
AA seq 504 aa AA seqDB search
MAMSLQGSRRASAGSRRRTSPPVSVRDAYGTASLSSSSNSGSCKGSDSSPTPRRSMKYTL
CSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQED
WIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETL
LHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQAGDPSNTPAEDR
ADSGFVAADDTLSRTEALEASSLLSSGVDCGFEEASLHSSFNLGPRFPASNTYEKLLCGM
EAAVQASCMQERAIQTDFVQYQPDLNTILEKVGQAQGCSSVLKDRHSELDLHPSGPRDPD
SAVVVTVGDEPEAPEPITRGPAIHRPAVNSNPGLPVSVVCPVEEEEEAAAAAAAAAAATT
TTTTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVA
LHSIRRISCSLSQPSAGSSGGSQL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtccctgcagggaagtagacgggcctctgccggatctcgcaggcgcacgtct
ccacctgtgagtgtgcgggacgcctacggcaccgcttccctcagcagcagcagcaactct
ggctcctgcaagggcagtgacagcagccccacaccgaggcgctccatgaagtacacactc
tgcagtgacaaccatggcatcaagcctcccaccccagagcagtacctgactccactgcag
cagaaggaggtttgtatccggcacctgaaggcccggctcaaggacacacaggaccggctc
caggatcgggacacagagatcgatgaccttaagacgcagctgtcccgcatgcaggaggac
tggatcgaggaggagtgccaccgcgtcgaggcccagctggctctgaaagaggcccgcaag
gagatcaggcagctcaagcaggtcatcgacactgtcaagaacaacctgatcgacaaggac
aaggggctgcagaagtactttgtggacatcaacatccagaacaagaagctggagacgctg
ctgcatagcatggaggtggctcagaatggagtagccaaggaggaaggaactggggagtcg
gcaggcgggtcccctgcgcgctccctcacccgcagctccacctacaccaagctgagtgac
ccagccgtctgtggggaccgccaggcaggggatccctccaacacccctgctgaggacaga
gctgatagcggctttgtggctgccgatgacaccctgagtcggacggaagccctggaggcc
agtagcctgctgtcatctggagtggactgtggctttgaggaagcctcgctgcacagctcc
ttcaacctgggcccccgcttccctgccagcaacacgtacgagaagctgctgtgcggcatg
gaggctgctgtgcaggccagctgcatgcaggagcgggccatccagacagacttcgtgcag
taccagcctgacctgaacaccatcctggagaaagtgggccaggctcaggggtgcagctcg
gtcctcaaggacaggcactcagagctggatctccacccttcagggcccagagaccccgac
tcagcagtggtggtaacagtaggtgacgagccggaggccccagagcccatcacccgcggg
ccagctatacaccggcctgcagtcaactctaacccaggactgccagtgagtgtggtgtgt
cccgtggaagaggaggaggaggcagccgccgccgccgccgccgccgccgccgccaccacc
accaccaccaccaccgaaaaggaacccaagagttactggagccgccactacatcgtggat
ctgctggctgtggtggtgccagctgtgccaacggtggcctggctctgccgctcccagagg
cgtcagggccagcccatttacaacatcagctccctgctgcggggctgctgcacagtggcc
ttgcactccatccgcaggatcagctgttcactgagccagccgagcgctggctcatccggt
ggctcccagctctga

DBGET integrated database retrieval system