KEGG   Rattus norvegicus (rat): 296269Help
Entry
296269            CDS       T01003                                 

Gene name
Angpt4, Agpt4
Definition
(RefSeq) angiopoietin 4
  KO
K05467  angiopoietin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    296269 (Angpt4)
   04015 Rap1 signaling pathway
    296269 (Angpt4)
   04010 MAPK signaling pathway
    296269 (Angpt4)
   04066 HIF-1 signaling pathway
    296269 (Angpt4)
   04151 PI3K-Akt signaling pathway
    296269 (Angpt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    296269 (Angpt4)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   296269 (Angpt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C ANAPC15
Motif
Other DBs
NCBI-GeneID: 296269
NCBI-ProteinID: NP_001099996
RGD: 1307539
Ensembl: ENSRNOG00000005008
UniProt: D3ZR43
Position
3q41
AA seq 508 aa AA seqDB search
MLRPPAMLLDGLLLLATMAAAQHRGPEASGRRQIHRVQHGQCSYTFVLPEPDICQLAPVA
PEGLGGSNSLQRDLPAARHHLTDWRAQRAQRAQRVSQLEKILENNTQWLLKLEQSIQMNL
RSDLAQAQQHTIQNQTTTMLALGANLMNQTMAQTHKLTAVEAQVLNHTSRVKTQMLESSL
STNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQLNSLQDKREQLQSLLGHQTG
ALANLKHSLRALSSNSSSLQQQQQQLMELVQRLVRIVAQDQHPVSLKTPKPLFRDCAEIK
RSGANTSGVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGN
VAREHWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQRYSLSVNDSSI
SARLKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYPVHQHLHK
INGIRWHYFRGPSYSLHGTRMMLRPMGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcccgccagctatgctactagatggcctcctcctgctggccaccatggctgca
gcccagcacagagggccagaagccagtgggcgccgccagattcaccgggtccagcacggc
cagtgtagctacacctttgtgctgcctgagccagatatctgccagctggcgccggtggca
cctgagggtttggggggctccaatagcctccagagggacttgcctgccgcaaggcaccac
ctaacagactggcgagcccagcgggcccagcgggcccagcgtgtgagccagctggagaag
attctagagaataacactcagtggctgctgaagctggagcagtccatccagatgaacttg
aggtcagacctggctcaggcccaacagcacacaatccagaaccagacgaccaccatgctg
gcactgggcgccaacctcatgaaccagaccatggctcagacccacaagctgactgctgtg
gaggcacaggtcctaaaccacacatctcgcgtgaagacccaaatgctggagagctcactg
tccaccaacaagctggagaggcagatgctgatgcagagccgcgagctgcagcggctgcag
ggccgcaacagggccctggagaccaggctgcaggcattggaggcacagcatcaggcccag
cttaacagcctccaagacaagagggaacaactgcaaagcctcctgggccatcagactggg
gccctggctaacctgaagcacagtctgcgagccctcagcagcaattccagctccctgcag
cagcagcagcagcagctgatggagctggtacagcgcctggtgcggattgtagcccaggac
cagcacccagtttccttaaagacgcctaagccgctgttccgggattgtgcagagatcaag
cgctctggagccaacaccagtggtgtctataccatccatggggccaacatgacaaagcct
ctcaaggtgttctgtgacatggagactgatggaggtggctggaccctcatccagcgcagg
gaggatggaagcttgaatttccagaggacttgggaggaatacaaagagggttttggtaat
gtggctagagaacactggctgggcaatgaggctgtgcacagcctcaccagcagaacggcc
tacttgctacgtgtggagctgcatgactgggaaggccaccagacctccatccagtatgag
aacttccagctgggcagcgagaggcagcggtacagcctctctgtgaatgacagcagcatc
tcagcaaggctcaagaacagcctggctcctcagggcaccaagttcagtaccaaagacatg
gacaatgataactgcatgtgcaaatgtgctcagatgctgtctggagggtggtggtttgac
gcctgtggcctctccaacctcaacggcatctactatccggttcatcaacacttgcataag
atcaatggcatccgctggcactacttccgaggccccagctactcactgcatggcacacgc
atgatgctgcggccaatgggtgcctga

DBGET integrated database retrieval system