KEGG   Rattus norvegicus (rat): 29627Help
Entry
29627             CDS       T01003                                 

Gene name
Gria2, GluA2, GluR-K2, GluR2, gluR-B
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 2
  KO
K05198  glutamate receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    29627 (Gria2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29627 (Gria2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29627 (Gria2)
   04728 Dopaminergic synapse
    29627 (Gria2)
   04720 Long-term potentiation
    29627 (Gria2)
   04730 Long-term depression
    29627 (Gria2)
   04723 Retrograde endocannabinoid signaling
    29627 (Gria2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29627 (Gria2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    29627 (Gria2)
  09165 Substance dependence
   05030 Cocaine addiction
    29627 (Gria2)
   05031 Amphetamine addiction
    29627 (Gria2)
   05033 Nicotine addiction
    29627 (Gria2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29627 (Gria2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   29627 (Gria2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 29627
NCBI-ProteinID: NP_001077280
RGD: 61862
Ensembl: ENSRNOG00000054204
UniProt: P19491
Structure
PDB: 
5NG9 5JEI 4IGT 4YU0 5NIH 5FTI 1MQI 4U21 6Q54 6FAZ 4FAT 4U2R 5NS9 4U22 4Z0I 3TKD 1MQD 1M5E 3H6W 4O3C 4LZ5 2XXH 2GFE 6Q60 5FHM 2XX8 3KGC 3DP6 4U4X 6HCH 5FHN 2XXI 1P1N 1P1O 1FTK 6HCC 2AL5 1MQJ 1MM7 1M5C 4U23 3RTF 3B6W 2AL4 1FTM 4IY6 1M5D 6GIV 3HSY 1WVJ 1MY3 6FQH 5O9A 5CBS 4O3A 4H8J 3PMV 3O6G 3O6I 1SYH 1P1W 1MXU 1MY2 1MQH 1LBC 1FTL 3T9X 4U1O 4LZ8 3M3L 3LSF 3H6U 1XHY 1NNK 1M5B 4N07 3T96 3PMX 3BKI 6HCA 4X48 6HCB 4YMA 4U4S 3TZA 3O2A 3H03 1NNP 1MXW 1MXZ 1MY0 1MY1 1MY4 1FW0 1FTJ 1GR2 4O3B 3T93 5ELV 4U1Z 6GL4 3TDJ 3O2J 3BFU 1MXV 1MXY 1M5F 4GXS 3T9U 2XX9 1MS7 6FQK 3T9V 5OEW 5CBR 4IY5 3O28 3ILU 3IL1 3IJO 3B6Q 1P1U 1P1Q 1MXX 1FTO 3T9H 3O29 4Q30 4G8M 5BUU 4LZ7 3RTW 3PD9 3O6H 3IK6 3H6V 3B6T 2ANJ 1SYI 1N0T 1LBB 3ILT 5FWY 3LSL 1MQG 1MM6 2AIX 3PMW 2XX7 3H6T 3BBR 2P2A 3BFT 5FHO 4ISU 2I3W 1LB8 1LB9 3H5V 6FQG 2UXA 6HC9 2I3V 3PD8 6FQJ 5FWX 3B7D 2CMO 3H5W 5N6P 4L17 3H06 3IJX 5FTH 6FQI 3N6V 4U2P 4U1W 4U1X 4U5B 4U5E 4U2Q 4U5D 3KG2 4U5C 4U5F 5L1H 4U1Y 5L1F 5L1B 6QKC 5L1E 4U4G 5L1G 5VHY 4U4F 5VOT 6QKZ 5VOU 6NJM 6NJN 6NJL 5KBV 5KK2 5VOV 5VHW 5IDE 5VHX 5VHZ 5IDF 4UQJ 4UQ6 4UQK
Thumbnails

Position
2q33
AA seq 883 aa AA seqDB search
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagattatgcatatttctgtcctcctttctcctgttttatggggactgattttt
ggtgtctcttctaacagcatacagataggggggctatttccaaggggcgctgatcaagaa
tacagtgcatttcgggtagggatggttcagttttccacttcggagttcagactgacaccc
catatcgacaatttggaggtagccaacagtttcgcagtcaccaatgctttctgctcccag
ttttcaagaggagtctacgcaatttttggattttatgacaagaagtctgtaaataccatc
acatcattctgtgggacactccatgtgtccttcatcacacctagcttcccaacagatggc
acacatccatttgtcatccagatgcgacctgacctcaaaggagcactccttagcttgatt
gagtactaccaatgggacaagttcgcatacctctatgacagtgacagaggcttatcaaca
ctgcaagctgttctggattctgctgcagagaagaagtggcaggtgactgctatcaatgtg
gggaacatcaacaatgacaagaaagatgagacctacagatcgctctttcaagatctggag
ttaaaaaaagaacggcgtgtaatcctggactgtgaaagggataaagtaaatgacattgtg
gaccaggttattaccattggaaaacatgttaaagggtaccattatatcattgcaaatctg
ggattcactgatggggacctgctgaaaattcagtttggaggagcaaatgtctctggattt
cagattgtagactacgacgattccctggtgtctaaatttatagaaagatggtcaacactg
gaagagaaagaataccctggagcacacacagcgacaattaagtatacttcggccctgacg
tatgatgctgtccaagtgatgactgaagcattccgtaaccttcggaagcagaggattgaa
atatcccggagaggaaatgcaggagattgtttggccaacccagctgtgccctggggacaa
ggggtcgaaatagaaagggccctcaagcaggttcaagttgaaggcctctctggaaatata
aagtttgaccagaatggaaaacgaataaactacacaattaacatcatggagctcaaaaca
aatggaccccggaagattgggtactggagtgaagtggataaaatggttgtcaccctaact
gagctcccatcaggaaatgacacgtctgggcttgaaaacaagactgtggtggtcaccaca
atattggaatctccatatgttatgatgaagaaaaatcatgaaatgcttgaagggaatgag
cgttacgagggctactgtgttgacttagctgcagaaattgctaaacactgtgggttcaag
tacaagctgactattgttggggatggcaagtatggggccagggatgccgacaccaaaatt
tggaatggtatggttggagagcttgtctacgggaaagctgacattgcaattgctccatta
actatcactctcgtgagagaagaggtgattgacttctccaagcccttcatgagtcttgga
atctctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcctttcttgat
cctttagcctatgagatctggatgtgcattgtgtttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggaatttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcggcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctg
tctaagcaaacagaaattgcttatggaacattagactctggctccactaaagagtttttc
aggagatctaaaatcgcagtgtttgataaaatgtggacttatatgaggagtgcagagccc
tctgtgtttgtgaggactaccgcagaaggagtagccagagtccggaaatccaaaggaaag
tatgcctacttgctggagtccacaatgaacgagtacatcgagcagaggaagccttgtgac
accatgaaagtgggaggaaacttggattccaaaggctacggcatcgccacacctaaagga
tcctcattaggaaatgcggttaacctcgcagtactaaaactgaatgaacaaggcctgttg
gacaaattgaaaaacaaatggtggtacgacaaaggagagtgcggcagcgggggaggtgat
tccaaggaaaagaccagtgccctcagtctgagcaacgttgctggagtattctacatcctt
gtcgggggccttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaaggtggcaaagaatccacagaatattaacccatcttcctcg
cagaattcccagaattttgcaacttataaggaaggttacaacgtatatggcatcgagagt
gttaaaatttag

DBGET integrated database retrieval system