KEGG   Rattus norvegicus (rat): 296293
Entry
296293            CDS       T01003                                 

Gene name
Cbfa2t2
Definition
(RefSeq) CBFA2/RUNX1 translocation partner 2
  KO
K22751  CBFA2/RUNX1 translocation partner 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    296293 (Cbfa2t2)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND BBS1
Other DBs
NCBI-GeneID: 296293
NCBI-ProteinID: NP_001162014
RGD: 1309088
Ensembl: ENSRNOG00000016352
UniProt: F1M659
Position
3q41
AA seq 594 aa
MVGVPGAAAFQLGCEKRVPAMPGSPVEVKIQSRASPPIMPPLPPINPGGPRPVSFTPTAL
SNGISHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQF
GNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQREL
LHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERD
TVPPEPTAKRVCTISPAPRHSPALTVPLLSAGGQFHPTPPPLQHYTLEDIATSHLYREPN
KMLEHREVRERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSM
AVLRRCQESDREELNYWKRRCNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPA
AGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQA
AEDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHG
HSPHSQSRSLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggtgggcgtccctggagcggccgccttccagcttggttgtgagaaaagggtgccagca
atgcctggatcgcctgtggaagtgaagatacagtcaagagcctcacctcccatcatgcca
cccctcccaccaataaatcctggaggaccgaggccagtgtcctttactcctacagcatta
agcaatggcatcagccattcccctcctaccctgaatggtgccccatcgccaccacagaga
ttcagcaacgggcctgcctcctccacgtcctcagcgctaacaaatcagcagttgccagct
acttgtggtgctcggcaactcagcaagttgaaacgctttctcactactctacaacagttt
ggcaatgacatctcacctgagattggcgagaaggttcggacgcttgttctagccttggtg
aactcaacagtgacaattgaagaattccattgcaagctccaggaggctacaaacttccca
cttcgtccatttgtaattccgtttctcaaggccaacctgcccctgctgcagcgagaactg
ctgcactgtgcccgggctgccaagcagaccccatcccagtacctggcccagcatgagcac
cttctgctcaacaccagtatcgcatctcctgctgactcttctgaactgcttatggaggtt
catggaaatggaaagaggcccagtcccgaaaggagggatgagaataattttgaaagagac
acagttcctcctgaaccgactgccaagagagtgtgcactatcagccctgctcctcggcac
agtcctgccctcactgttcccctcctgagtgccgggggccagttccatcctactccacca
cctcttcagcactataccttagaagacatcgcaacttctcacctgtatcgggaaccaaac
aagatgctagaacaccgagaagttcgtgagaggcaccacaatcttagtctcaatggaggc
tatcaagatgagttggtagaccaccgtttgacagaaagggagtgggccgatgaatggaaa
catcttgaccatgccctgaattgcatcatggaaatggtggaaaaaacgaggcgctccatg
gctgtcctgaggcgctgtcaggaatctgaccgtgaagagcttaactattggaaaagacga
tgtaatgaaaatacagagttgaggaagactgggaccgagttggtctctaggcagcacagc
cctgggagtacagattctctcagcaacgattctcagcgggaattcaccagtaggccagca
gcaggatacgtgcctgtagagttttggaagaaaactgaagaagctgtgaacaaggtgaaa
attcaggccatgtcagaggtacaaaaggctgtagctgaggcagagcaaaaagcctttgaa
gtgattgcaactgagagagctcgaatggagcaaaccatagcggatgtcaaaaggcaggcg
gcagaagatgctttcctggtcatcaatgagcaagaagagtccacagagaactgctggaac
tgtggccgaaaagccagtgagacgtgcagtggctgcaatattgctcgctactgtggctcc
ttctgccagcataaggactgggagcggcaccaccgcctctgtggccagagtctacatggc
cacagtccccacagccagagccggtcactgctccctggagggcggggctcagccaggtct
gctgactgcagtgtgcccagcccagccctggacaagacctcagctaccacctcacggtcc
tcaacacctgcctctgtgacagccattgatgccaacgggctctga

DBGET integrated database retrieval system