KEGG   Rattus norvegicus (rat): 296306Help
Entry
296306            CDS       T01003                                 

Gene name
Ergic3, Sdbcag84
Definition
(RefSeq) ERGIC and golgi 3
  KO
K20367  endoplasmic reticulum-Golgi intermediate compartment protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296306 (Ergic3)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    296306 (Ergic3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPIIcoated_ERV ERGIC_N
Motif
Other DBs
NCBI-GeneID: 296306
NCBI-ProteinID: NP_001100003
RGD: 1308144
Ensembl: ENSRNOG00000031085
UniProt: D3ZU83
Position
3q42
AA seq 383 aa AA seqDB search
MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV
DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGIPVSSEAE
RHELGKVEVTVFDPDSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIE
QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI
NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF
SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG
LIDSLIYHSARAIQKKIDLGKTT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctggggaagctgaagcagttcgatgcctaccctaagactctggaggacttc
cgggtcaagacctgcgggggcgccacggtgaccatcgtgagtggccttctcatgctcctg
ctgttcctgtctgagttgcagtattatctcaccaccgaggtgcatcctgagctctacgtg
gacaagtctcggggggataaactgaagatcaacatcgatgttcttttcccacacatgcct
tgtgcctacttgagcatcgatgccatggatgtggccggggagcagcagctggatgtggag
cacaacctgttcaagaaacgactggacaaggatggcatccccgtgagctcagaggctgaa
cggcatgagcttgggaaagtcgaggtgacagtgtttgacccagactccctggaccccaat
cgctgtgagagctgctatggtgcggaatcagaagatatcaagtgctgtaacagttgtgaa
gatgtgcgggaagcgtatcgccgccgaggctgggccttcaagaacccagacactattgag
cagtgtcgacgggagggcttcagccagaagatgcaggagcagaagaacgagggctgccag
gtgtacggcttcttggaggtcaacaaggtggctgggaacttccactttgcccctgggaag
agcttccagcagtcccatgtgcacgttcatgacttacagagctttggccttgacaatatc
aacatgacccactacatcaagcacttgtcattcggggaggactatcccggcattgtgaac
cccctggaccacaccaacgtcactgcaccgcaagcctccatgatgttccagtactttgtg
aaggtggtgcctacagtgtacatgaaagtggacggggaggtgctgaggacaaaccagttc
tctgtgaccaggcacgagaaggttgccaatggcctactgggtgatcagggcctgccgggg
gtctttgtgctgtatgagctctcaccaatgatggtgaagctgacagagaaacacaggtcc
ttcacgcacttcctgacgggtgtgtgtgccatcattggaggcatgtttacagtggctgga
ctcattgactcactcatctaccactcggctcgggccatccagaagaaaattgatctgggg
aagacaacctag

DBGET integrated database retrieval system