KEGG   Rattus norvegicus (rat): 29631
Entry
29631             CDS       T01003                                 

Gene name
Bet1
Definition
(RefSeq) Bet1 golgi vesicular membrane trafficking protein
  KO
K08504  blocked early in transport 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    29631 (Bet1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29631 (Bet1)
Membrane trafficking [BR:rno04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    29631 (Bet1)
SSDB
Motif
Pfam: Sec20 Use1 DUF4407
Other DBs
NCBI-GeneID: 29631
NCBI-ProteinID: NP_062124
RGD: 2203
Ensembl: ENSRNOG00000011008
UniProt: Q62896
Position
4q13
AA seq 118 aa
MRRAGLGDGAPPGGYGNYGYANSGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQ
NKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaggcgtgcaggcctgggtgatggagcacctcctggcggctatgggaactatggttat
gccaatagtggatataatgcttgtgaagaagagaatgacagactcactgaaagtctcaga
agcaaagtaacagctataaaatctctttccattgagataggccatgaagtcaaaaatcaa
aataaactgttagctgaaatggattcacaatttgattctacaactggatttctaggtaaa
accatgggaagactgaagattttgtccagagggagccaaacgaaattgctatgctatatg
atgctgttttcattgtttgtcttttttgtcatttattggattattaaactgaggtga

DBGET integrated database retrieval system