KEGG   Rattus norvegicus (rat): 296320
Entry
296320            CDS       T01003                                 

Gene name
Ctnnbl1
Definition
(RefSeq) beta-catenin-like protein 1
  KO
K12864  beta-catenin-like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    296320 (Ctnnbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    296320 (Ctnnbl1)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    296320 (Ctnnbl1)
 Complex C
   Prp19-CDC5 complex
    296320 (Ctnnbl1)
SSDB
Motif
Pfam: CTNNBL SAGA-Tad1
Other DBs
NCBI-GeneID: 296320
NCBI-ProteinID: NP_001020041
RGD: 1563558
Ensembl: ENSRNOG00000012021
UniProt: Q4V8K2
Position
3
AA seq 563 aa
MDVGELLSYQPNRGTKRPRDDEEEELKTRRKQTGPRERGRYREDEATAAEDADDDKKRLL
QIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDI
IQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEG
AEVLIDALVDGQVVALLVQNLERLDESVREEADGVHNTLAIVENMAEFRPEMCTEAAQQG
LLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHN
PSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMNLMLREKKISRSSALKVLDHA
MIGPEGADNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRG
QQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDIVRRGEIIDNDMEDE
FYLRRLDAGLFILQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI
GDGRSPEFRETEQKRILGLLENF
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggacgtgggcgaacttttaagctaccagcccaacaggggcacaaaacgaccccgggat
gatgaggaagaagaactgaagactcgtcgaaaacaaactggtcctcgagaacgaggtcgc
tatcgtgaagacgaggccacagcagctgaagacgcagatgatgacaagaaaaggctgctg
cagattattgacagggacggcgaggaagaggaggaggaggaggaaccgctggatgaaagc
tcagtgaagaagatgatcctcacattcgaaaagcgatcgtacaaaaaccaggagctgcgg
atcaagtttccagacaatccagagaagttcatggaatccgagctggacctcaatgatatc
attcaggagatgcatgtggtggccaccatgcctgacctgtaccaccttctcgtggagctg
agcgctgtgcagtcgcttctcggcttgctgggacacgataatacagatgtgtccatagct
gtggtcgatctccttcaggagctgacagacatagacaccctccacgagagtgaagaagga
gcagaagttctcatcgatgcccttgtggatggacaggtggtcgcactattggtgcagaat
ctggagcgcctggatgagtctgtgagggaggaggctgatggtgtccacaacaccctagct
attgtggagaacatggcggagttccgtccagagatgtgcacggaggctgcccagcaggga
ctcctgcagtggctgttgaagaggctaaaggccaagatgccctttgatgccaacaagctc
tactgcagcgaagtgctggccatcctcctccaggacaatgatgaaaacagggaattgctg
ggagagctggatggaatcgatgtgcttcttcagcagttatccgtatttaaaagacacaac
cccagcaccgctgaggagcaggagatgatggagaacctgtttgacgccctctgttcctgc
ttgatgctcagctccaatcgggagcgcttcctgaagggtgagggccttcagctcatgaac
ctcatgctcagggagaagaagatctcccggagcagtgccctgaaggtactggaccacgcc
atgattgggccggaaggcgcagacaactgccacaagtttgttgacattctgggcttacgg
accatctttccactcttcatgaagtctccccggaagatcaagaaggtgggaaccacagag
aaggaacacgaagagcatgtctgttcgatcctggcttccctcctgcgcaacctgagaggg
cagcagcggacccggcttctgaataaatttacggagaacgacagtgagaaggtcgacaga
ctaatggagctgcattttaaatatctaggtgcaatgcaggtggctgacaagaagattgaa
ggggagaaacatgacatagtgcggcgtggggagatcatagacaatgacatggaggacgag
ttctacctgcggcgcctggatgccggcctcttcatcctacagcacatctgctacatcatg
gcggagatctgcaatgccaatgtcccccagattcgccagcgagttcaccagatcctgaac
atgcgtggcagctccatcaagatcgtcaggcacatcatcaaggagtacgcagagaacatt
ggagatggccggagccctgagttccgagagaccgagcagaagcgcatcctgggcttgttg
gagaacttctag

DBGET integrated database retrieval system