KEGG   Rattus norvegicus (rat): 29634
Entry
29634             CDS       T01003                                 

Gene name
Ldhc, Ldh3
Definition
(RefSeq) lactate dehydrogenase C
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29634 (Ldhc)
   00620 Pyruvate metabolism
    29634 (Ldhc)
   00640 Propanoate metabolism
    29634 (Ldhc)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    29634 (Ldhc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    29634 (Ldhc)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    29634 (Ldhc)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    29634 (Ldhc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29634 (Ldhc)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     29634 (Ldhc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   29634 (Ldhc)
  Exosomal proteins of breast milk
   29634 (Ldhc)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N ThiF
Other DBs
NCBI-GeneID: 29634
NCBI-ProteinID: NP_058962
RGD: 69366
Ensembl: ENSRNOG00000013103
UniProt: Q6AYX2
Position
1q22
AA seq 332 aa
MSTVKEQLIQNLAPDEKQSRCKITVVGVGNVGMACAISILLKGLADELALVDADENKLKG
EALDLLHGSLFLSTPKIVFGKDYSVSANSKLVIITAGARMVSGESRLALLQRNVTIMKAI
VPGVIQNSPDCKIMIVTNPVDILTYVVWKISGLPVSSVIGSGCNLDSARFRYLIGEKLGV
NPSSCHGWVLGEHGDSSVPIWSGVNIAGVTLKSLNPAIGSDSDKEQWKTVHKQVVDGGYE
VLNLKGYTSWAIALSVTDIAASILKNLKRVHAVTTLVKGLYGIKEEIFLSIPCVLGQSGI
TDLVKVNMNTEEEALFKKSCDILWNIQKDLQL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtccactgtcaaggagcagctaattcagaacctagctccagatgaaaaacaatcccgg
tgtaagatcactgtggtcggagttggaaatgtgggcatggcgtgtgccattagtatttta
ctgaagggtctggctgatgaacttgcccttgttgatgctgatgagaacaaactgaaggga
gaggcactggatcttctgcatggcagccttttcctcagcactccaaaaatcgtctttgga
aaagattacagtgtatctgccaactccaaactggttattatcactgctggtgcaagaatg
gtgagtggagaatctcgtcttgccctgctccaacgtaatgtcactatcatgaaagccatc
gttcccggcgtaatccaaaacagtccggactgtaaaataatgattgtcacaaacccagtc
gatattttgacatacgtggtttggaagataagtggcctccctgtaagcagtgtgattgga
agtggctgtaacctagactccgctcgtttccgttacctgattggagagaagctgggtgtc
aacccttcgagctgccatggctgggttcttggagaacatggggactccagtgtgcccata
tggagtggtgtgaacattgctggcgtaactctgaagtcactgaacccagcaataggatcc
gactccgataaggaacagtggaaaaccgttcacaagcaggtggtggatggtggctatgag
gtccttaacctgaagggctatacctcttgggccattgcgctgtctgtgactgatatcgct
gcatcaatcttgaagaatcttaagagggtgcatgctgttactacgctggttaagggctta
tatgggataaaggaagaaatcttcctcagtatcccgtgtgtcttgggacaaagtggcatc
acagaccttgtgaaagtcaacatgaacaccgaggaggaagctctttttaagaagagttgc
gacatactctggaacatccagaaagatctgcaattataa

DBGET integrated database retrieval system