KEGG   Rattus norvegicus (rat): 296344Help
Entry
296344            CDS       T01003                                 

Gene name
Mybl2
Definition
(RefSeq) myeloblastosis oncogene-like 2
  KO
K21769  myb-related protein B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    296344 (Mybl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    296344 (Mybl2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    296344 (Mybl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 SLIDE Spore_III_AB Sigma70_r4_2
Motif
Other DBs
NCBI-GeneID: 296344
NCBI-ProteinID: NP_001100006
RGD: 1308474
Ensembl: ENSRNOG00000007805
UniProt: D3ZLC6
Position
3q42
AA seq 704 aa AA seqDB search
MSRRTRCEELDELRYQDTDSDLLEQRDNKCKVKWTHEEDELLRALVRQFGQQDWKFLASH
FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
KRKVDTGGFPNESRDCKPVYLLLELEDKDYQQNVQPVEGPGSLVSSWPLAPSTVKEEESS
EEEAAVATTSKEHKQEPVPTDLGEVRTPEPLEFLKREYQEESSPETSLPYKWVVEAANLL
IPAVESSLSEALDLIESDPDAWCDLSKFDLPEEPSAEGSVNSSPVQLQTPQQQQQHQQAL
SFHQAATPGPSVTEYRLDGHTISDLSRSSRGELIPISPSTEFGGSGIGTPPSVLKRQKKR
RVALSPVTENSASLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTST
PVCSQKVVVTTPLHRDKTPLHQKYPSFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLP
QTPHLEEDLKEVLRSEAGIELIIEDDMRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDGK
MMSSTSPKTLSLPTSVPSSSSGFILPGIKEDNSLLNQGFLQAKPEKVVATQKPRSHIPAP
APMTRAWKTVACGGTKDQLFMQEKARQLLGRLKSSHTSRTLILS
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggcggacgcgctgtgaggaactggatgagttacgctaccaggacacggactca
gacctcctggagcagagagacaacaaatgtaaggtcaaatggacccacgaggaggatgag
ctactgagggccctggtgaggcagtttggacagcaagactggaagttcctggccagtcac
tttcctaaccgcacagaccagcaatgccagtaccggtggctgagggttttgaatccagac
cttgttaagggaccgtggaccaaagaggaagatcagaaggtcattgagctggtcaagaag
tacggcacaaaacagtggacgctcattgccaagcacctgaagggccgtcttgggaagcag
tgtcgtgagcgctggcacaaccatctcaaccctgaggtgaagaagtcctgctggacagag
gaggaagatcggatcatctgtgaggcccataaagtgctgggcaaccgctgggctgagatc
gccaagatgctgccagggaggacagacaatgctgtgaagaatcactggaattccaccatc
aaaaggaaagtcgacacgggagggttcccaaacgagtccagagactgcaagcctgtctac
ttgctcttggagctcgaggacaaggattaccaacagaatgtccagcctgtggaaggcccg
ggaagtcttgtgagcagctggcccctggcgccctctactgtgaaggaggaggagagcagc
gaggaggaggctgccgtggctactacttctaaggaacacaagcaggagcccgtccccact
gatctgggggaagtgcgcaccccagagcccctggaattcctcaagcgtgaataccaggag
gaatcctccccagaaacaagcctgccctacaagtgggtggtggaggccgcgaacctcctc
atccctgctgtggagtccagcctctccgaagctctggacttgatcgagtcggaccccgat
gcttggtgtgacctcagtaaatttgatcttcctgaagaaccgtctgcagagggcagtgtc
aacagtagcccagtgcaactccagacaccgcagcagcagcaacagcaccagcaggcactg
tcattccaccaggctgccacaccagggcccagtgtgactgagtatcgccttgatggccac
actatttcagacctgagccggagcagccggggagagctgatccccatttccccaagcact
gagtttgggggctcaggcattggcacaccgccctcagtgctcaagcgacagaagaaacgg
cgcgtggccctgtcgcctgtcacagagaacagtgccagcttgtccttcctggactcctgt
aatagccttaccccgaagagcacacctgtcaaaacccttcccttctctccttcccagttt
ctgaacttctggaacaaacaggataccctggagttggagagcccctccctgacgtccact
ccggtgtgcagccaaaaggtggtagtcaccacacccttgcacagggataagacgcccctg
caccagaagtatccatcgtttgtaaccccagatcagaagtattccatggacaacactccc
cacacaccaaccccgttcaagaatgctctggagaaatatggaccactgaaacccctgccc
caaaccccacacctggaagaggacttgaaggaggtgcttcgttccgaggctggcattgag
ctcatcattgaggatgacatgagacccgagaaacagaagagaaagcctgggctccggcga
agccctatcaagaaggttcggaagtctctggctcttgacattgtggatgaggatgggaag
atgatgtcatcgacctcgcccaagactctgtccttgccaaccagtgtcccatccagctcc
tctggcttcatcttgccgggtatcaaggaggataacagcctgctcaaccagggcttccta
caggccaaacccgagaaggtggtggccacccagaagccccggagccacattccagcccct
gctcctatgacccgtgcctggaagacggtggcctgtgggggcactaaagaccagctcttc
atgcaagagaaggcccggcagctcctgggccgtctgaagtccagccacacatctcggacc
ctcattctgtcctga

DBGET integrated database retrieval system