KEGG   Rattus norvegicus (rat): 296366Help
Entry
296366            CDS       T01003                                 

Gene name
Wfdc3
Definition
(RefSeq) WAP four-disulfide core domain 3
  KO
K23637  WAP four-disulfide core domain protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    296366 (Wfdc3)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I17: WAP-type family
   296366 (Wfdc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WAP
Motif
Other DBs
NCBI-GeneID: 296366
NCBI-ProteinID: NP_001100011
RGD: 1305295
Ensembl: ENSRNOG00000042162
UniProt: D4A5P8
Position
3q42
AA seq 137 aa AA seqDB search
MLRYLFLMNALLALGLLASWVAAGEHELRGECPADPLPCQELCTGDASCPQGHKCCSTGC
GHACRGDIEGGRDGQCPRILVGLCIVQCMMDENCQPGERCCKSGCGRFCIRGLRPLQQLT
DSNRTDGFNSTLEAQVP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgttaagatacctcttcctcatgaacgcacttcttgctcttgggctcctggcatcttgg
gtagctgcaggagagcacgaattaagaggtgaatgtcctgctgaccctctcccatgtcag
gagctgtgtactggggatgcatcctgtccccaggggcacaaatgctgcagcacagggtgt
ggccatgcctgccgaggagacattgagggagggcgggatggtcaatgtcccagaattctg
gtaggcctgtgtattgtccagtgcatgatggatgagaactgtcaacctggggaaaggtgc
tgtaaatcaggctgtggccgcttctgcatccggggactccggcccctccaacagctcaca
gactccaaccggacagatggctttaactctacattagaggctcaagtaccctag

DBGET integrated database retrieval system