KEGG   Rattus norvegicus (rat): 296368Help
Entry
296368            CDS       T01003                                 

Gene name
Ube2c
Definition
(RefSeq) ubiquitin-conjugating enzyme E2C
  KO
K06688  ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    296368 (Ube2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    296368 (Ube2c)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     296368 (Ube2c)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   296368 (Ube2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con UEV RWD
Motif
Other DBs
NCBI-GeneID: 296368
NCBI-ProteinID: NP_001100012
RGD: 1305382
Ensembl: ENSRNOG00000015131
UniProt: D3ZUW6
Position
3q42
AA seq 179 aa AA seqDB search
MASQNRDPAAASVAAVRKGAEPCGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKD
KWSALYDVRTILLSIQSLLGEPNIESPLNTHAAELWKNPTAFKKYLQETYSKQVSNQEP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgcagaaccgcgacccagctgcagccagcgttgccgccgttcgaaaaggagca
gaaccctgcgggggcgccgcccggggccctgtgggcaagaggctacagcaggagctgatg
accctcatgatgtctggtgacaaaggaatttccgccttccccgaatcagacaacctgttc
aaatgggtaggaaccatccatggagccgccggcactgtatatgaagacctgaggtataaa
ctctccctagagttccccagtggctacccttacaacgcacccacagtgaagttcctcaca
ccgtgctaccaccccaacgtggacacccagggcaacatctgcctggacatcctcaaggac
aagtggtctgcactgtatgatgtcaggaccatcttgctctccatccagagcctgctagga
gaacccaacatcgagagccctttgaacacacatgctgcagagctctggaaaaaccccaca
gcatttaagaagtacctgcaagaaacatattcaaagcaggtctccaaccaagagccctga

DBGET integrated database retrieval system