KEGG   Rattus norvegicus (rat): 29637
Entry
29637             CDS       T01003                                 

Gene name
Hmgcs1
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, cytoplasmic
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno00650  Butanoate metabolism
rno00900  Terpenoid backbone biosynthesis
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
Module
rno_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    29637 (Hmgcs1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    29637 (Hmgcs1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    29637 (Hmgcs1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    29637 (Hmgcs1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     29637 (Hmgcs1)
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N
Other DBs
NCBI-GeneID: 29637
NCBI-ProteinID: NP_058964
RGD: 70970
Ensembl: ENSRNOG00000016552
UniProt: P17425
Position
2
AA seq 520 aa
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCT
DREDINSLCLTVVQKLMERNSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAIYASGNARPTGGVGAVALL
IGPNAPVIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDGKLSIQCYLSALDRCYSVYRKKI
RAQWQKEGKDKDFTLNDFGFMIFHSPYCKLVQKSLARMFLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAP
DVFAENMKLREDTHHLANYIPQCSIDSLFEGTWYLVRVDEKHRRTYARRPSTNDHSLDEG
VGLVHSNTATEHIPSPAKKVPRLPATSGEPESAVISNGEH
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcctgggtcacttcctttgaatgcagaggcttgctggccaaaagatgtgggaatcgtt
gcccttgaaatctactttccttctcagtatgttgatcaagctgagttggaaaaatacgat
ggtgtagatgctggaaagtataccattggcctgggccaggccaggatgggcttctgcacg
gatcgcgaagacatcaactctctctgcctgactgtggttcagaaactgatggagagaaat
agcctttcctatgactgcattgggcggctggaagtcgggacagagacaatcatcgacaaa
tcaaaatccgtgaagtctaatttgatgcagctgtttgaggagtctgggaatacagatata
gaaggaatagatacaactaatgcatgctatgggggcacagccgcagtcttcaatgctgtg
aactggatcgaatccagctcttgggatggacgatacgctttggtagttgcaggagacatc
gctatatatgcctcaggaaacgccaggcctacaggtggagttggagctgtggctctgcta
attgggccaaatgctcctgtaatttttgaccgagggcttcgtgggacacacatgcagcat
gcctacgacttttacaagcctgacatgctctctgaataccctgtggtagatggaaaactc
tccatacagtgctacctcagcgcattggaccgctgctattctgtctaccgcaaaaagatc
cgggcccagtggcagaaagagggaaaggataaagattttaccctgaatgattttggcttc
atgatctttcactcgccatactgtaaactggtgcagaaatctctagctaggatgttcctg
aatgactttcttaacgatcaaaacagagacaaaaacagtatttacagtgggctggaagcc
tttggggatgtgaaattagaagatacttacttcgacagagatgtggaaaaggcatttatg
aaggctagtgctgagctattcaaccagaaaacaaaggcatctttgcttgtatcgaatcaa
aatggaaacatgtacacatcctctgtatacggttcccttgcttctgttctggcacagtac
tcacctcaacagttggccgggaagaggattggagtgttctcttacggttctggcttggct
gccacactctactcccttaaagtcacacaagatgccacaccaggatctgctcttgacaaa
ataacagcaagtttatgtgaccttaagtcaaggcttgactcaagaacgtgtgtggcacca
gacgtctttgctgaaaacatgaagctcagagaggacacacatcacttagccaactatatt
ccccagtgttcaatagattcactcttcgaaggaacatggtatctagtcagagtggatgaa
aagcacagaagaacttacgcccggcgtccctccacaaatgaccacagtttggatgaagga
gtgggacttgtgcattcaaacacagctacagagcatattccaagcccggctaagaaagtg
ccaagacttcctgcgacctcgggcgaacctgagtcggctgtcatcagtaacggggagcac
tga

DBGET integrated database retrieval system