KEGG   Rattus norvegicus (rat): 296370Help
Entry
296370            CDS       T01003                                 

Gene name
Ctsa, Ppgb
Definition
(RefSeq) cathepsin A
  KO
K13289  cathepsin A (carboxypeptidase C) [EC:3.4.16.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    296370 (Ctsa)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    296370 (Ctsa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    296370 (Ctsa)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    296370 (Ctsa)
   04131 Membrane trafficking [BR:rno04131]
    296370 (Ctsa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296370 (Ctsa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.5  carboxypeptidase C
     296370 (Ctsa)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S10
   296370 (Ctsa)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Other peptidases
   296370 (Ctsa)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    296370 (Ctsa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   296370 (Ctsa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S10
Motif
Other DBs
NCBI-GeneID: 296370
NCBI-ProteinID: NP_001011959
RGD: 1309070
Position
3q42
AA seq 493 aa AA seqDB search
MTSSPKAAPGEQGHKEAEMPRAALSPLLLLLLLSWASRDEAAPDQDEIDCLPGLAKQPSF
RQYSGYLKASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDG
VTLEYNPYSWNLIANMLYIESPAGVGFSYSDDKMYVTNDTEVAENNYQALKDFYHLFPEY
KDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGL
LGNRLWTSLQTHCCSQNKCNFYDNKDPDCVNNLQEVSRIVGKSGLNIYNLYAPCAGGVPG
RDRSEDTLVVQDFGNIFTRLPLKRRFPEALLLRSGDKVRLDPPCTNTTAPSTYLNNPYVR
KALHIPESLPRWDMCNLMVNLQYRRLYESMNSQYLKLLSSQKYQILLYNGDVDMACNFMG
DEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAA
FTMFSRFLNKEPY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacttccagtccaaaggcggctccaggagagcaaggacacaaggaagcagagatgccc
cgagcagcactgtctccactgctcctgctgctgctcctatcctgggcgtcccgggacgaa
gcagctccggaccaggatgaaatcgattgcctcccgggcctggccaagcagccctctttc
cggcagtactccggctatctcaaagcatcggattccaagcacttccactactggtttgtg
gaatcgcagaacgaccctaagaacagccccgtggtgctttggctcaatgggggtcctggc
tgcagctccctagatgggttacttacagagcacggtcccttcctgatccagccagatggt
gtcaccctggagtacaacccctattcttggaacctgattgccaacatgctgtatatcgag
tccccagctggggtgggcttctcctactcggatgacaagatgtatgtgaccaatgacaca
gaggtggctgagaacaattatcaagcccttaaagacttctaccacctctttccggagtac
aaggacaacaaacttttcctgaccggagagagctatgctggcatctacatccccaccttg
gctgtactggtcatgcaggatcccagcatgaaccttcaggggctggctgtgggcaatgga
ctctcctcctatgagcagaatgacaactccctggtctactttgcctactaccatggtctt
ctggggaacaggctttggacttcactccagacccactgctgttctcagaacaagtgtaac
ttctatgacaacaaagatccagattgtgtaaacaatctccaggaagtgtctcgaattgtg
ggcaaatctggcctcaacatatacaatctctacgccccgtgtgctggtggggtacccggc
cgtgataggtctgaggacacacttgtagtccaggattttggcaatatcttcactcgcttg
ccactcaagaggagatttcctgaggctctactgcttcggtctggggacaaggtacgcttg
gatcctccatgcaccaacaccacagccccctccacctacctcaacaacccatatgttcgg
aaggctctccacatcccggagtcgctgccccgctgggacatgtgcaacctcatggtgaac
ttacagtaccgccgtctctacgaaagcatgaactcccagtacctgaagttgctcagctca
cagaaataccagatcctgctttacaatggcgatgtggacatggcctgcaacttcatgggg
gatgagtggtttgtggattccctcaaccagaagatggaggtgcagcgccggccctggcta
gtggactacggggagagtggagagcaggtagctggctttgtgaaggaatgctcacacatt
accttcctcaccatcaagggtgccggacacatggtccccacggacaagcctcgagctgct
tttaccatgttctctcgattcctgaacaaggagccttactga

DBGET integrated database retrieval system