KEGG   Rattus norvegicus (rat): 296374Help
Entry
296374            CDS       T01003                                 

Gene name
Zmynd8, Prkcbp1, spikar
Definition
(RefSeq) zinc finger, MYND-type containing 8
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3544 Bromodomain PHD PWWP zf-MYND DUF1640
Motif
Other DBs
NCBI-GeneID: 296374
NCBI-ProteinID: NP_001094308
RGD: 1309544
Ensembl: ENSRNOG00000019154
UniProt: A8C4G9
Position
3q42
AA seq 1208 aa AA seqDB search
MDISTRSKDPGSTERTAQKRKVPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSSKDQSE
LRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSE
PEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLE
QHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKV
VIKICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKD
GQVDARFFGQHDRAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRKKFGVF
NYSPFRTPYTPNSQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKIILSKPLLSGGA
GRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDKSTASPASTK
TGQAGSLSGSPKPFSPQAPTPIMTKPDKTSTATTGSILNLNLDRSKAEMDLKELSESVQQ
QSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSESS
DSEYVSDEEQKPKNEPEDPEDKEGSRVDKEAPAIKRKPKPSNQVEVKEEVKSNSPVGEKV
DPAPAKDKASPEPEKDFAEKAKPSPHPTKDKLKGKDETDSPTVHLGLDSDSESELVIDLG
EDPSGREGRKNKKEPKVPSPKQDAIGKPPPPTPAGNQSPPETPVLTRSATQAPAAGVTVA
ATTSTMSTVTVTAPATAAVTGSPVKKQRPLLPKETVPAVQRVVWNASSKFQTSSQKWHMQ
KIQRQQQQQQQQQQQQQSQQQQPQSSQGTRYQTRQAVKAVQQKEVTQSPSTSTITLVTST
QPAALVSSSGSASTLASVINADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSK
NTTGSTIAEIRRLRIEIEKLQWLHQQELAEMKHNLELTMAEMRQSLEQERDRLIAEVKKQ
LELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQ
QEADAEANQETGNKTSQGSSSNTQSAPSEPASTPKEKETSSSSSNSSSTEKSKDSNSTLD
LSGSRETPSSILLGSNQGSDHSRSSKAGLWSSSEEKRGSSRSEHSAGTSTKNLMPKESRE
SRLDTFWD
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggacatctctactcgctccaaagatcctggctctaccgagagaacggcccagaaacgg
aaggtccccagccccccacattcctccaatggccattcgccccaggactcatccacaagc
cccattaaaaagaaaaagaaacccggcttactgaacagtagcagtaaggatcagtcagag
ctaagacatggtccgttttactatatgaagcagccactcaccacagaccctgttgatgtt
gtaccgcaggacggacggaatgacttctattgctgggtttgtcaccgggaaggacaagtc
ctttgctgtgagctctgtccccgggtttatcacgctaagtgtctgagactgacatcggaa
ccagagggggactggttttgtcctgaatgtgagaagattacagtagcagaatgcatcgag
acgcagagcaaagccatgaccatgctgaccatcgaacagctgtcctacctgctcaagttt
gctattcagaaaatgaagcagcccgggacggacgcattccagaagcccgttccgttggaa
cagcaccccgactatgcagagtatattttccatcccatggatctttgcacgttggaaaag
aatgcaaaaaagaagatgtatggctgtacggaagccttcctggctgatgccaagtggatc
ctgcacaactgcattatttataatgggggaaaccacaagttgacgcaaatagcaaaggtt
gtcatcaagatctgtgagcacgagatgaatgaaattgaagtatgcccagaatgttatctc
gcagcttgccagaaacgagacaactggttctgtgagccctgtagcaatccgcaccctttg
gtctgggcaaaacttaaaggattcccattctggccagcgaaagctctgagggacaaagac
ggacaggttgatgcccgtttctttggacaacatgacagagcctgggttccagtcaataat
tgctacctcatgtcaaaagaaatccccttttctgtgaaaaagactaagagtatcttcaac
agcgccatgcaggagatggaagtttacgtggagaacatacggaagaagttcggggttttt
aattactccccgttcaggacgccctacacccccaatagccagtaccaaatgctgctggat
cccagcaatcccagcgccggcactgccaagacagacaaacaggagaaggtgaagctcaat
tttgacatgacggcgtcccccaagatcattctgagcaagccccttctgagcgggggcgcg
ggccgcaggatctccctgtccgacatgcctcgctcccccaccagcacgaactcctctgtg
cacacgggctccgatgtggagcaggaccccgagaagaaggccccatccagccacttcagc
gcaagcgaagagtccatggacttccttgataagagcacagcgtctccagcctccaccaag
acggggcaagcagggagcttgtccggcagcccgaagcccttctctccacaagcgccaacg
cccatcatgacgaaacctgacaagacctccaccgccaccaccgggagcatcctgaacttg
aacctggatcgaagcaaagccgagatggacctgaaggagctgagcgagtcggtccagcag
cagtcagctcccgtccccctcatctctcccaagcggcaaattcgaagccgtttccagctc
aacctggacaagaccatagagagttgcaaagcacagctaggcataaacgagatctcggag
gacgtttatacggccgtggagcacagcgactcagaggattcggaaaagtcagagagcagc
gacagcgagtacgtcagcgacgaggaacagaagcccaagaatgagccggaggaccccgag
gacaaggaggggagccgggtggacaaagaggcccctgccatcaaaaggaagcccaagccc
tcgaaccaggtggaggtcaaagaggaagtgaagagtaactcgcccgttggagagaaagtg
gaccccgcacccgccaaggacaaggccagccccgagcccgagaaggactttgcagagaaa
gcaaagccatcccctcaccccacgaaggacaaattgaagggaaaggatgagacagattct
cccacagtgcacttgggcttggattcggactcagagagcgaacttgtcatagacttagga
gaagatccttctgggcgggagggtcgaaaaaacaagaaagagcccaaggtgccgtcgccc
aagcaggatgccataggtaaaccgccaccacccactccggccggcaaccagtctccccca
gagacgccggttctcacccgctcagccacgcaagcacctgcggccggggtcaccgtggct
gccaccaccagcacgatgtctaccgtcacggtcacagcgccggccaccgccgccgtcacc
ggaagcccagtgaagaagcagaggccgctcttaccgaaggagactgtcccagccgtgcag
cgggtcgtgtggaacgcatcaagtaagtttcaaacgtcctcccaaaagtggcacatgcag
aagatacagcgccagcagcagcagcagcagcaacagcagcagcaacagcagagccaacag
cagcagcctcagtcttcccaggggacaagatatcagaccagacaggccgtgaaagctgtc
cagcagaaggaggtcacccagagcccgtccacatccaccatcacgctggtgaccagcaca
cagccggcagccctggtcagcagctcgggctctgccagtaccttagcgtctgtgatcaac
gctgacctgcccattgccactgcctcagccgatgtggctgcggacattgccaagtacacc
agcaaaatgatggacgccataaaggggactatgacagaaatctacaacgacctctccaag
aacaccactgggagcacaattgctgagattcgaaggctgaggattgagattgagaagctg
cagtggctgcaccagcaggagctcgccgagatgaagcacaacttggagttgaccatggca
gagatgcggcagagcttggaacaggagcgggatcggctcatcgccgaggtgaagaagcag
ctggagctggagaagcagcaggcggtggacgagaccaagaagaagcagtggtgtgccaac
tgcaagaaggaggccattttttactgctgctggaacaccagctactgcgactacccctgt
cagcaggcccactggcccgagcacatgaagtcctgtacccagtcggctaccgcccctcag
caggaagcggatgctgaggcaaaccaggaaacaggaaataagacatctcagggcagctct
tccaatacacagtcagcaccttcagaaccagccagcacccccaaagagaaagagacgtcg
tcatcgtcctcgaattcctcctcaacggagaagagcaaggacagtaactcgaccctggac
ctttccggctccagagagacgccctcctccattctcttaggctccaaccaaggctctgac
cattcccggagcagcaaggcgggtttgtggagcagcagcgaggaaaagcgagggtcatcc
cgctccgagcacagtgcagggaccagcacgaagaacctcatgcccaaagagtcccgggag
tctaggctagacaccttctgggactag

DBGET integrated database retrieval system