KEGG   Rattus norvegicus (rat): 29639Help
Entry
29639             CDS       T01003                                 

Gene name
Fxyd2, ATP1C, Atp1g1, GNAKATP
Definition
(RefSeq) FXYD domain-containing ion transport regulator 2
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    29639 (Fxyd2)
   04022 cGMP-PKG signaling pathway
    29639 (Fxyd2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    29639 (Fxyd2)
   04918 Thyroid hormone synthesis
    29639 (Fxyd2)
   04919 Thyroid hormone signaling pathway
    29639 (Fxyd2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29639 (Fxyd2)
   04261 Adrenergic signaling in cardiomyocytes
    29639 (Fxyd2)
  09154 Digestive system
   04970 Salivary secretion
    29639 (Fxyd2)
   04972 Pancreatic secretion
    29639 (Fxyd2)
   04976 Bile secretion
    29639 (Fxyd2)
   04973 Carbohydrate digestion and absorption
    29639 (Fxyd2)
   04974 Protein digestion and absorption
    29639 (Fxyd2)
   04978 Mineral absorption
    29639 (Fxyd2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    29639 (Fxyd2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    29639 (Fxyd2)
   04964 Proximal tubule bicarbonate reclamation
    29639 (Fxyd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29639 (Fxyd2)
   04147 Exosome [BR:rno04147]
    29639 (Fxyd2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29639 (Fxyd2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29639 (Fxyd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 29639
NCBI-ProteinID: NP_663769
RGD: 2173
Ensembl: ENSRNOG00000016469
UniProt: Q04679
Position
8q22
AA seq 66 aa AA seqDB search
MTELSANHGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLILLSKRFRCGGSKKHRQ
VNEDEL
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgacagagctgtcagctaaccatggtggcagtgccaaggggacggagaatcccttcgag
tatgactatgaaaccgtccgcaaaggaggcctgatcttcgcgggccttgccttcgtcgtg
ggactcctcattctcctcagcaaaagattccgctgtgggggcagtaagaagcataggcag
gtcaatgaagatgagctgtga

DBGET integrated database retrieval system