KEGG   Rattus norvegicus (rat): 296395
Entry
296395            CDS       T01003                                 

Gene name
Kcng1, Kh2, Kv6.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily G member 1
  KO
K04900  potassium voltage-gated channel subfamily G member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    296395 (Kcng1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   296395 (Kcng1)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2
Other DBs
NCBI-GeneID: 296395
NCBI-ProteinID: NP_001100015
RGD: 631416
Ensembl: ENSRNOG00000054314
UniProt: D4AD53
Position
3q42
AA seq 514 aa
MTLLPGDNSDYDYSALSCASDTSFHPAFFPQRQAIKGVFYRRAQRLGPQDDLHQSISLGD
RRRQIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILSVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMM
EREDEEEALDSEDQESEGPSTSEGRLSRCMRRLRDMVEKPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGQCSQMCHNVFIVESVCVGWFSLEFLLRFIQAPSKFAFLRSP
LTLIDLVAILPYYVTLLVDGAASSRRKPSTGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVLIR
RAQYLIKTKSQLSGMSQDSDILFGSASSDTRDNN
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgaccctgttaccaggagacaactcggactatgactatagtgctctaagttgtgcctca
gacacctccttccacccagccttcttcccacagcgccaggccatcaaaggcgtcttctac
cgcagggcccaacggttgggaccgcaggacgacctgcaccagagcatctcacttggggac
cgcaggcgacagatcatcatcaacgtgggtgggatcaagtactcactaccttggaccaca
ctggatgagttccccctgacgcggctgggccagctcaaggcctgcaccaacttcgacgac
atcctgagcgtgtgtgatgactatgacgtaacctgcaacgagttcttcttcgaccgcaac
ccgggggcctttggcaccatcctcaccttcctgcgggccggcaagctgcgcctgcttcgg
gagatgtgcgccctgtccttccaggaggagctgctgtactggggcattgcggaggaccac
ctggacggctgctgcaagcgccggtacctgcagaaaatcgaggagtttgctgagatgatg
gagagggaggatgaggaggaggcgctggacagcgaggatcaagagagtgagggtccatcc
accagcgagggtcgcctgagccgctgcatgaggaggctgcgtgacatggtggagaagcca
cactcagggttgcctggcaaggtgtttgcctgcctgtctgttctgtttgtcaccgtcacc
gctgtcaacctgtctgtcagcaccctgcccagcctgcgtgaggaggaggaacagggccag
tgttcccaaatgtgccacaacgtcttcatcgtagagtcggtgtgcgtgggctggttctcc
cttgagttcctgctgcggttcatccaggcacccagcaagttcgccttcctgcggagcccg
ctgaccctcatcgatctggtggccatcctgccttactacgtcacactgctggtggatggc
gctgcctccagccgccgcaagccaagcaccggcaacagctacctggacaaggttgggctg
gtgctgcgcgtgctgcgggcgctgcgcatcctctacgtgatgcgcctggcccggcattcc
ctggggctgcagaccctgggcctcaccgcacgccgctgcacgcgtgaattcgggcttctg
ctgcttttcctgtgtgtggccatcgctctctttgccccactgctctacgtcatcgagaat
gagatggcagacagccccgaattcaccagcatcccggcctgctactggtgggctgtcatc
accatgacaaccgtgggctacggagacatggtaccccggagcacgccgggccaggtggtg
gctctgagcagcatcctcagcggcatcctcctcatggccttcccggtcacctccatcttc
catactttctcccgctcttacctggaactcaagcaggaacaagaacgggtgctgatccgc
cgggcccagtacctcatcaaaaccaagtctcagctcagtggcatgtcccaagacagtgac
atcttgtttggaagtgcctcttcagacactagggacaacaactga

DBGET integrated database retrieval system