KEGG   Rattus norvegicus (rat): 29642Help
Entry
29642             CDS       T01003                                 

Gene name
Slc38a2, Ata2, Atrc2, Sat2, Snat2
Definition
(RefSeq) solute carrier family 38, member 2
  KO
K14207  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04724  Glutamatergic synapse
rno04727  GABAergic synapse
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    29642 (Slc38a2)
  09156 Nervous system
   04724 Glutamatergic synapse
    29642 (Slc38a2)
   04727 GABAergic synapse
    29642 (Slc38a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29642 (Slc38a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   29642 (Slc38a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 29642
NCBI-ProteinID: NP_851604
RGD: 69420
Ensembl: ENSRNOG00000006305
UniProt: Q9JHE5
Position
7q35
AA seq 504 aa AA seqDB search
MKKTEMGRFNISPDEDSSSYSSNGDFNYSYPTKQAALKSHYVDVDPENQNFLLESNLGKK
KYETDFHPSTTSFGMSVFNLTNAIVGNGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGHKAYGLAGKLAASGSITMQNIGAMSSYLFIVKYELPLVIKAL
MNIEDTNGLWYLNGDYLVLLVSFVLILPLSLLRNLGYLGYTSGLSLLCMIFFLIVVICKK
FQIPCPVEVALMANETVNGTFTQVALAALASNSTAADTCRPRYFIFNSQTVYAVPILTFS
FVCHPAVLPIYEELKSRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLHTY
SAIVGTDILLLVVRLAVLVAVTLTVPVVIFPIRSSVTHLLCPTKEFSWFRHSVITVTILA
FTNLLVIFVPTIRDIFGFIGASAAAMLIFILPSAFYIKLVKKEPMRSVQKIGALCFLLSG
VVVMIGSMGLIVLDWVHDASAGGH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaccgaaatgggaaggttcaacatctccccggatgaggacagcagcagttac
agctccaacggtgacttcaactactcataccccacgaagcaggctgctctaaaaagccat
tatgtggacgtggaccccgaaaaccagaactttttacttgaatcgaatctggggaagaag
aagtacgaaacagactttcatccaagtactacttcctttggaatgtcagtatttaatctg
accaatgcgattgtgggcaatggaatccttgggctttcttatgccatggctaatactgga
attgctctttttataattctcttgacgttcgtgtcgattttttctctgtactccgttcac
ctcctcctcaagactgccaacgaaggagggtctttattatacgaacagttgggacataag
gcatacggtctggctgggaagctggcagcctccggatcgattacaatgcagaacatcgga
gctatgtcaagctacctcttcatagtgaaatatgagttacctttggtgatcaaggcgtta
atgaacattgaagatacgaatgggctgtggtatctgaacggcgactatctggtccttctg
gtgtccttcgtgctcattctcccattgtcactgctgagaaatctaggatacttggggtat
accagcggcctttctctgctctgtatgatattctttctgattgtggtgatttgcaagaag
tttcagattccttgccctgtggaagtggctttgatggctaacgaaacggtgaatggcacc
tttacccaggtggctttggcagcgctggcgtccaacagcaccgcagccgatacctgcagg
ccccgttactttatcttcaactcacagactgtgtatgctgtgcccatcctgacgttttcc
tttgtctgccatcccgctgtccttcccatctatgaagagctgaagagccgcagccggaga
aggatgatgaacgtgtccaagatttctttcttcgccatgtttctgatgtatttgcttgcc
gccctcttcggatacctgacattttacgagcacgtggagtcagaactgctacatacctac
tctgcgatcgtgggaactgacattctcctcctcgttgtccgcctggctgtgctggtggct
gtcaccctcactgtccccgtcgtcattttcccaatccggagttcggtcactcacttactg
tgccctacaaaagagttcagttggttccggcacagtgtcattactgtgacgatcctggcc
ttcaccaatttgctcgtcatctttgtccccactatcagggacatcttcgggttcattggt
gcatcggccgctgcaatgctgatcttcatccttccgtctgctttctacatcaagttagtg
aagaaagaacccatgagatccgtgcaaaagattggggctctgtgttttctcctgagtggc
gtagtcgtgatgattggaagcatgggcttgattgtcctggactgggtccacgatgcctct
gcaggcggacattaa

DBGET integrated database retrieval system